KEGG   Olleya sp. Bg11-27: CW732_06165Help
Entry
CW732_06165       CDS       T05214                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oll  Olleya sp. Bg11-27
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oll00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CW732_06165
  Energy metabolism
   00680 Methane metabolism
    CW732_06165
Enzymes [BR:oll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CW732_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1408871..1411450
Genome map
AA seq 859 aa AA seqDB search
MSLQPKLTRFNQNVLSKYQIYNGIFMTLPFDTITKTGVLLPLFHETCKNGFDGGDNPTVI
VDTFFKKYQARRSDKSKIDLLFRFIQYIERQVVLFDAIEDAAFPIVNNMDGIGTLRSLKE
SAAAEGKLDKLREYLEEFKVRIVLTAHPTQFYPGAVLGIITDLTEAVKQNDLLRINDLLA
QLGKTPFFKHEKPTPYDEAVSLIWYLENVFYDSFGTIYDYIQQNIFDGQHIDNEIINIGF
WPGGDRDGNPFVTPEITVKVAKRLHETIIKNYHKDIRKLKRKLTFQGVEARVSKIESELY
KKILNEKSSITLEGFVSELKEIRQIIIDKHQSLYVTEITSLLNKLHLFGFHFSSLDIRQD
SRVHHSIFTTMVDSMIENGSKDIPGNYHELPEKEQVKLLSEVKGTVDLSLIKDEETLKAL
NTIKALKSIQETNGELAANRYIISNNQTTLHVMQLFAMLKLVAFQDDLTVDVGPLFETIT
DLENAHLVMEELYTNPAYAKHLKARGNKQTIMLGFSDGTKDGGYLMANWAIYKAKERLTA
ISRKYDVTVIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDS
SQYNLEQLISSGIYNSLSDTDLRMVPENRVVMDNLAKLSYEAYVDFKNHPKFISYLEHMS
TLKYYAKTNIGSRPSKRGKAEGLVFEDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDA
GEFEKAQKLFQTSSFFKTLIENSMMSLSKSFFDLTKYMSDDPEYGAFWNVIYTEYKTTKR
LILKLTGYTELMEEEPSGKASIKVRESIVLPLLTIQQFALKQIQELEKADEKDTELIAVY
EKLVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacaacctaaattaacacgttttaatcaaaatgtattgtcaaaatatcaaata
tataatggtatttttatgacactgcctttcgatactattacaaaaacaggagtcttactt
cctttgtttcatgaaacctgtaaaaacggatttgatggaggagataacccgacggtgatt
gtcgatactttttttaaaaaatatcaagcaagacgttctgataaaagtaaaatagattta
ttatttcgttttattcaatatatagaacgccaagtcgttttatttgatgctatagaggat
gctgcatttcctattgttaataatatggacgggattggtacgcttcgtagtttaaaagaa
agcgctgctgcggaaggtaaactggataaattacgtgagtatttagaagaatttaaagtt
aggattgtgctaaccgcccatccaacacaattttatcccggagcagttttgggtatcatt
acagatttgacagaggcagtaaaacaaaatgatctattgagaatcaacgatttattggct
caattagggaaaacacctttttttaagcatgaaaaaccaacaccttatgatgaggcagtt
agtttaatttggtatttagaaaatgtgttttatgactctttcggaacaatttatgactat
atccaacaaaatatttttgatggtcaacatatagataacgagattattaatattggattt
tggccaggaggagatagagatggtaatccatttgtaacaccagaaatcacggtaaaagta
gccaaaaggttacatgaaactattataaaaaattaccataaagatattagaaagttaaag
cgtaaactgacttttcaaggggtagaagcacgtgtttctaaaatagaaagcgaattatat
aaaaagattcttaacgaaaaatcgagtattactttagagggttttgtttcagaattaaaa
gaaattagacaaattataattgataaacatcagtctttatatgttacggagattactagt
ttgttaaataagttacatttatttggttttcatttttcaagtttagacatacgccaagat
agtagagtacatcactcaatatttacaacgatggtggattctatgatagaaaatggaagt
aaagatatacctggtaattatcatgagttaccagaaaaggagcaagtaaaactattatct
gaggtaaaagggactgtagatttatctttaattaaagacgaagaaacacttaaagcactt
aatactataaaagcattaaagtctattcaagagaccaatggagagttggcagcaaaccgt
tatattataagtaataaccaaaccactttacatgtcatgcaattatttgctatgcttaaa
ttggttgcttttcaggatgatttaactgtggatgttggaccgcttttcgaaactattacc
gatttagaaaatgcgcatttagtaatggaagagttgtatactaatcctgcttatgctaaa
cacttaaaagccagaggaaataaacaaacgatcatgttagggtttagtgatgggacaaaa
gatggtggttatttaatggctaactgggctatttataaagcaaaagagcgtttaacagct
atttctagaaaatatgatgttactgtgatcttttttgatgggcgtggtggaccgcctgca
cgtggaggcggaaaaacacataatttttatgcgtctttagggccaacaattgaggataaa
gaagtacagttaactatccaaggacaaacgattagttctaattttggtacgttagattcg
tcacaatataacttagagcagttaattagttctgggatttataatagtttaagtgataca
gatttacgtatggtgccggaaaatagagtggttatggataatcttgcaaagcttagttat
gaagcttatgtcgattttaaaaatcaccccaagtttatatcgtacttagaacatatgagt
accttaaaatattatgcaaaaactaatattggaagtcgaccatcaaaacgagggaaggcc
gaaggtttagtgtttgaagatttaagagctataccatttgtagggtcttggagtcaatta
aaacagaacgtcccaggatttttcggtgtgggtacagctttaaaacattatgaagatgct
ggcgaattcgaaaaagctcaaaaattatttcagacatctagtttctttaaaacattaata
gaaaacagtatgatgtctttatcaaaatcattttttgatttgacaaagtatatgagtgac
gatcctgaatatggagcattttggaatgtgatttatacggagtataaaacaacaaaacgt
ctaattttaaaacttactggttatacagaattgatggaggaagagccttcaggaaaagcg
tctataaaagttagagaatctattgtattgccattattaacaatccaacaatttgcttta
aagcaaattcaagaattagaaaaagccgatgaaaaggatacagaactaattgcagtttat
gaaaaactagtaacacgttcattatttggaaatattaacgccagtcgtaattcagcataa

DBGET integrated database retrieval system