KEGG   Olsenella sp. oral taxon 807: ADJ70_02065Help
Entry
ADJ70_02065       CDS       T04016                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
olo  Olsenella sp. oral taxon 807
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:olo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ADJ70_02065
  Energy metabolism
   00680 Methane metabolism
    ADJ70_02065
Enzymes [BR:olo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ADJ70_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2085015..2087765)
Genome map
AA seq 916 aa AA seqDB search
MDQLKDEIAAKVANSSLGERELEQIVARSTVSVVDIPDELKENLALFLRLVRTVLAEFDP
KLREAFDQLLADSITVNARADGDADEGAFKDASAIIETLDVESAVMLARAFAAFFHLANI
CEEDYRVRSLRAREAAVPTIADEDPVNDITVAYRRLVEECGQDEASALLGRLEFHPVFTA
HPTEARRKAVEGKIRRISALLEERAQASGIALAENERRMLQEIDALLRTSPIAIKKPTPV
QEAETVIDIFDHTLFDMIPEVYRRFDDWELGDKAGTVPPVCPAFFHPGSWIGSDRDGNPN
VTAKLSRQVAERYRAHVLEKLADATYAVGSSLTLDTSSTKPSDQLLNLWSHQVEMSESLT
DHARAISASETHRASMIIMSHRLRATIDRTADLMYANADEYLKDLYCVQRSLAEAGAVRA
AYGPVQKLIWQAQTFGFHLVEMEFRQHSLVHSRALKDIREHGRWCERGELQPMTREVLDT
FRAIGSIQRRNGTRAACRYIISFTQSAQNVADVYELARLAFAHTQDVPTLDVIPLFEQIR
DLENAVDILDEIIKLPPVRERLEQTGRKLEVMLGYSDSSKDEGPTAATLVLHGAQERIAR
WAEKMDIDLVLMHGRGGAVGRGGGPANRAVLSQPTGSVNCHFKLTEQGEVIFARYGNPTL
ALRHVESVAGATLLQSAPSIGYVNGESTKKYADMAALLDSASRERYLDLLGTDGFVEWFS
SVTPLAEIGLMPIGSRPAKRGLGAQSLDDLRAIPWIFSWSQARVNLAAWYGLGSACERVG
DLGLLRDAYAEWPLFTTFIDNVEMSLSKADERLAKMYLSLGGRTDLSEKVLDELRLTLRW
VLAITDDERPLGNRRILGPVIRLRLPFVNALSLIQVLALRRLRERGESLTPEERDRLTYL
ILCTVSGVSAGLQNTG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atcgaccagctgaaggatgagatagccgccaaggtggccaatagcagtcttggcgagagg
gaactcgagcagatcgttgcgcgctctactgtctcggtcgtggatataccggatgagctc
aaggagaacctcgcgctctttttgcgcctggtgcgtacggtccttgcggagttcgaccct
aagctgcgcgaggccttcgaccagctgctcgctgactcgatcacggtcaacgccagggca
gatggcgatgcggatgagggggccttcaaagacgcctccgctatcatcgagacgcttgac
gttgagtcggcggtcatgctggcgcgtgccttcgccgccttctttcacctcgctaatatc
tgtgaggaggactatcgtgttcgctcgctgcgtgcacgcgaggccgccgttcccacgatc
gccgatgaggatccggtcaacgacatcacggttgcctatcgtcgactcgtggaggaatgc
ggacaggacgaggccagcgcgcttctcggtcgcctggagtttcatcccgtcttcaccgcg
catcccaccgaggcgcgccgcaaggccgtcgaaggcaagattcggcgtatctcggccctg
ctcgaggagcgggcccaggcaagtggtatcgcgcttgccgagaacgagcgccggatgctc
caagagatagacgcccttttgcgcacttctcccatcgccatcaagaagccgactcccgtc
caagaggccgagaccgtcatcgatatctttgaccatacgctctttgatatgattcctgag
gtttatcgacgtttcgatgactgggagctgggcgacaaggccggcaccgtgccgcccgtc
tgtcctgccttcttccatccgggcagctggataggctccgaccgtgacggcaaccccaac
gtgacggccaagctgtcgcggcaggtagccgagaggtaccgtgcgcatgtgctcgagaaa
ctcgctgatgccacctacgcggtcggcagcagcctcacgctcgataccagctctactaaa
ccttcagaccaactgctcaacctctggagccaccaggtcgagatgagcgagtctctgacc
gaccatgctcgtgcgatctcggcctccgagacccatcgcgcatcgatgatcatcatgtct
catcggctgcgtgccacgatcgaccgtaccgcagatctcatgtacgcgaacgcggacgag
taccttaaagatctctattgcgttcagcgctcgcttgccgaggcaggtgccgtccgcgcg
gcctatggtcctgtgcagaagctcatctggcaggcacagaccttcggcttccaccttgtc
gagatggagtttcgccagcactcgcttgtgcacagtcgtgcccttaaggacatacgcgag
cacgggcgttggtgtgagcgtggcgagctgcagcccatgacccgcgaggtgcttgacacc
ttccgcgcaatcggttccattcagaggcgcaatggcaccagggctgcctgtcgctacatc
atctcgtttacgcagagcgcccagaacgtcgccgacgtctatgagctggcgcgtctcgcc
tttgcccatacgcaggacgtccccacgctcgacgttattcccctcttcgagcagatacgg
gatctcgagaacgccgtggacatccttgatgagatcatcaagcttcctcctgtgcgggaa
cgtctcgagcagacgggacgcaagcttgaggtcatgctcggctactcagactcatccaag
gacgagggtccgacggccgcgacgctcgtcctgcatggtgcccaggagcgcatcgcgcgc
tgggccgaaaagatggacattgaccttgtgctcatgcacggtcgtgggggtgccgtggga
cgcgggggtggtccggcaaaccgtgcggtcctctcgcagcccacggggtcggtgaactgt
cacttcaagcttaccgagcagggcgaggtcatctttgcccgctacggcaacccgaccttg
gccctgcgtcacgtcgagtcggtcgccggagcgacgcttttgcagagcgccccctccata
ggatacgtgaacggggagtcaacgaagaagtatgcggacatggctgcccttctcgacagc
gcctcgcgcgagcgctatctcgatcttttgggtacggacggctttgtcgagtggttctct
agcgtgacgccgcttgccgagattggcctcatgcccataggtagccgcccagctaagcgc
ggccttggcgcccagtccctcgatgacctccgtgcgattccctggatcttctcctggtcg
caggcgcgcgtcaacctagcggcatggtatggactgggatcagcctgcgagcgtgtcggt
gaccttggacttctgcgggacgcctatgcggagtggcctctcttcacgaccttcatcgac
aacgttgagatgtcgctctccaaggctgatgagcggctggccaagatgtatctctcgctt
ggcgggcgcacggacctctcagagaaggtgctggacgagttgcgcctgacactcaggtgg
gtgcttgccatcacggatgatgaacgacctctcggcaaccgtaggatccttggtcccgtt
attcggctcaggctaccgttcgtgaatgcgctctccctcatacaggtgttggcgctcagg
cgacttcgcgaacgtggcgagagccttacacccgaggagcgagatcgtctcacctacctg
atcttgtgcaccgtgtccggcgtgtcagccggcctgcagaacacggggtga

DBGET integrated database retrieval system