KEGG   Olsenella uli: Olsu_0594Help
Entry
Olsu_0594         CDS       T01285                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ols  Olsenella uli
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Olsu_0594
Enzymes [BR:ols01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Olsu_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(664499..665794)
Genome map
AA seq 431 aa AA seqDB search
MAVVYTAFCTDIIHEGHLNIIRNAQRYGEVVLGALSDKALIRYNKFPTISQDERIRLYES
LEGVSRVIVQDDYLYDAVIEQLRPDYVIHGDNWQSGPESVIRANVLDLLSRFGGELIEVP
YTRSEEARKIDQQLREKLAMPEYRRRRLRQLLEISPTVKVIEAHDGLTGLIAEKTVVDHD
NRLDQFDGMWVSSLCDSTERGKPDIELVDMSARLRTIDDIMEVTTKPIILDGDTGGLTEH
FVYNVRTLERMGVSAVIIEDKTGLKKNSLFGTEVKQTQAPIDEFCAKIAAGKKVQLTDDF
MIIARIESLILERGMEDALTRAFAFRDAGADGIMIHSRKKDPSEIYEFCDRFRAQDSKTP
IVVVPTSFNGETEEELSAHGINIVIYANQLIRAAFPAMQETARGILKAHRALEVDEQLMP
FKEIITLIDEL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgtctataccgcattctgcaccgacatcatccacgagggacacctgaacatc
atcaggaatgcccagcggtatggcgaggtcgtcctgggagccctcagcgacaaggcgctc
attcgctacaacaagttcccaaccatctcccaggacgagaggatacggctctacgagtcc
cttgagggcgtctcccgggtcatcgtccaggacgactatctctacgacgccgtcatcgaa
cagctcaggcccgattacgtcatccacggtgacaactggcagagcggccctgaaagcgtc
attcgcgccaacgtccttgatctcctctcccgctttggaggcgaactgatcgaggtcccc
tacactagaagcgaggaagcacgcaagattgaccaacaactccgcgagaagctggccatg
cccgagtaccgccgccgccgcctgaggcagctgctcgagatctcccccactgtcaaggtc
atcgaggcccatgacggactcacgggtctcatcgccgagaagacggtcgtcgaccatgac
aacaggctcgatcagttcgacggcatgtgggtaagctcgctctgcgacagcaccgagcgc
ggcaagcctgacatcgaactcgtcgacatgtccgcacgcctacgcacgatagacgacatc
atggaggtcaccaccaagccaatcatcctcgatggtgacacgggtgggctgaccgagcac
ttcgtgtacaacgtccgcacccttgagcgtatgggcgtctccgccgtcatcatcgaggac
aagacgggtctgaagaagaactccctcttcggcaccgaggtcaagcagacccaggctccc
atcgacgaattctgtgccaaaatcgcagctggcaagaaggtccagctcaccgatgacttc
atgatcatcgcgcgtatcgaaagcctgattcttgagcgtggcatggaagatgcgctcacc
cgtgccttcgcgttcagggatgccggggcggatggcatcatgatccacagtcgcaagaag
gatccctccgagatctacgagttctgcgaccgcttccgcgcacaggacagcaagacgccc
atcgtcgtcgtgccgacctcttttaacggcgagaccgaggaggagctctcggcccatggc
atcaacatcgtgatctacgccaaccagctgattcgagccgcattccccgccatgcaggaa
actgcgcgcggcattctgaaggcccaccgcgcgctcgaggtcgacgagcagcttatgccc
ttcaaggaaatcatcaccctcatcgacgagctatag

DBGET integrated database retrieval system