KEGG   Oleiphilus messinensis: OLMES_5514Help
Entry
OLMES_5514        CDS       T04860                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ome  Oleiphilus messinensis
Pathway
ome00020  Citrate cycle (TCA cycle)
ome00480  Glutathione metabolism
ome01100  Metabolic pathways
ome01110  Biosynthesis of secondary metabolites
ome01120  Microbial metabolism in diverse environments
ome01130  Biosynthesis of antibiotics
ome01200  Carbon metabolism
ome01210  2-Oxocarboxylic acid metabolism
ome01230  Biosynthesis of amino acids
Module
ome_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ome_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ome00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OLMES_5514
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OLMES_5514
Enzymes [BR:ome01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     OLMES_5514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ARU59494
UniProt: A0A1Y0IJD2
LinkDB All DBs
Position
6249302..6251530
Genome map
AA seq 742 aa AA seqDB search
MTKPISKIIYTQTDEAPALATYSLLPIISAFAQKADVEVETSDISLSARILANFPENLTD
EQKVPDALTELGELALDPSANIIKLPNISASIPQLKAAIAELQSQGFDIPDYPEDPQNDQ
EADIKDRYSKVLGSAVNPVLRQGNSDRRAPAAVKAYARKHPHSMGPWSQASQTHVAHMRH
GDFYSSEQSTVVEKEGDVRIEFVAENGDIRVLKEKTHVLAGEVIDSMRMKAQALRDFFED
QLNDAKNTNLLFSLHVKATMMKVSHPIVFGHCVTVFYKDLFEKHAETFEELGVDPKNGLS
NVYQKIEQLPFSKRSEVEEDILACYQNRPEIAMVNSDKGISNLHVPSDVIVDASMPAMIR
NSGKMWGPDGKLKDTKAVIPDSTYATIYQEVINFCKHNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFELEGTGVVRVVDEAGTVLMQHDVEKGDIWRMCQTKDAPIRDWVKLAVNRAR
ATGSPAVFWLDPKRAHDTQLIHKVTEYLKEHDTDGLDIQIMSPVNAIRFTMERLKDGEDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSVVPMMAGGGMYETGAGGSAPKHVQQFVEEAH
LRWDSLGEFLALAVSLEDLGNKTGNNRAKILAKTLDQAIEKLLDNDKSPSRKVGEIDNRG
SHFYLALYWAKFLGSQSEDTELQTIFSGLAQSISENRSKIIEELSAAQGRPMDIGGYYHP
DIEKVTGAMRPSETFNTILANL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacctatatcgaaaattatctatacccaaaccgatgaagcaccggcgctggca
acttactcgttgctgccgatcatcagcgcattcgctcaaaaggcggatgtcgaggttgaa
accagtgatatttccctttcagccagaatactcgccaactttccagaaaacctgaccgat
gaacaaaaagtgcctgatgcactgaccgaactcggagagcttgcactagatccgagcgca
aacatcatcaaactgcccaatatcagtgcatctattccacaattgaaggctgccattgcg
gagttacagtcccagggattcgatattccagactatcctgaagaccctcaaaacgatcag
gaagcggatattaaagatcgttattcaaaagttttgggcagcgcagtcaatccagtgcta
cggcagggtaactccgaccgacgtgcacctgcagcagtaaaagcctacgcccgcaagcac
cctcattcaatgggaccatggagccaggcttcacaaacccacgttgcccatatgcgccat
ggtgatttctattccagtgaacaatccactgtagtcgaaaaagaaggtgatgttcgcatc
gaatttgttgccgaaaatggcgacatcagagtattgaaagaaaaaactcatgttctggct
ggcgaagtaatcgacagcatgcgcatgaaagctcaagcacttcgggactttttcgaagac
cagctaaacgatgcaaaaaacaccaatttgctgttttcactgcacgttaaagccaccatg
atgaaagtgtcgcacccgattgtgttcggtcattgtgtcacagttttttataaagacctg
ttcgagaaacacgcagaaacctttgaagagctgggtgttgatcctaaaaacggcttgagc
aacgtctaccagaaaattgaacaattacctttctcaaaacgttccgaagttgaagaagat
attctggcttgttaccagaaccgcccggaaattgccatggttaactccgacaaaggcatc
tccaacttgcacgtacccagtgacgtcatcgttgatgcatccatgccggccatgattcga
aattccggcaagatgtggggaccggacggaaaactgaaagataccaaagcggttattcca
gacagcacttacgcaaccatttaccaggaagttatcaacttctgcaaacacaatggcgca
ttcgatcccaccaccatgggcaccgtgccgaacgttggcttgatggctcaaaaggctgaa
gaatatggctcccatgacaagactttcgaactggaaggtaccggtgttgtgcgcgttgtt
gatgaagctggcacagtcttgatgcaacacgatgttgaaaaaggcgacatctggcgtatg
tgtcaaaccaaggatgcgccgattcgtgactgggtgaagcttgcggtgaaccgcgcccgg
gcgacaggttcccctgcggtgttctggctcgatcccaaacgtgcccacgatacccagttg
atccacaaagtcaccgaatacctgaaagaacatgatacagacggcctggatattcagatc
atgtcaccggtcaatgccattcgcttcacaatggagcgtctgaaagacggggaagatacc
atttctgtaaccggtaacgttttacgtgattatctgacggacctgttcccgattctggaa
ctgggaaccagtgcaaaaatgctgtctgtcgtgcccatgatggctggtggcgggatgtat
gaaaccggtgccggtggatccgcaccgaagcacgttcaacaattcgtcgaagaagcgcac
ctgcgttgggattcgctgggtgagttcctggcacttgcggtttccctggaggatctgggc
aacaaaaccggaaacaacagagcgaaaattctggccaaaaccctggatcaagcgatcgaa
aaactactggataacgataaatcaccttcacgtaaagtgggtgaaatcgataaccgtggc
agccatttttacctggcactgtactgggcgaaattcctgggctcacaaagcgaagatacg
gaactgcaaaccatcttcagtggcctggcgcaatccatttcagaaaatcgctccaagatt
attgaagaactgagtgcagctcaaggtcgcccgatggatatcggtggttattaccatccg
gatattgaaaaagtaaccggggcaatgcgtcccagtgaaacattcaataccatactggct
aacttgtaa

DBGET integrated database retrieval system