KEGG   Oscillatoria nigro-viridis: Osc7112_0330Help
Entry
Osc7112_0330      CDS       T02375                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Osc7112_0330
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Osc7112_0330
   00680 Methane metabolism
    Osc7112_0330
Enzymes [BR:oni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Osc7112_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
379782..382907
Genome map
AA seq 1041 aa AA seqDB search
MSSVLQSSEQAIDATSISHSPAYSKSDLFLRNRLKVVEDLWESVLRQECGQELVDLLQQM
RSVNSAEGQATHFRESNVVQLIEKLDLNAAIRAARAFALYFQLINIVEQHYEQRDQQLAY
ASSNDAGGRMFSKLPGQAMDAPDRPRHREGPGPAQMALNKADSSETIARDAGTFHQLFPM
LLRLNVPSQQIQRLIDQLDIRLVFTAHPTEIVRHTIRTKQRRMAKILQQLDQVDEKFQVI
GAESPSPYPVSCWEAAALQEQLMEEIRLWWRTDELHQFKPTVLDEVEYTLHYFEEVLFDA
IPELYHRLKQALHASYPYLKPPSYNFCKFGSWVGSDRDGNPSVTPKVTWQTACYQRHLVL
QKYISAVKRLNELLSLSLHWSDVLPELLESLDRDKSEFPDVYEQWAIRYRQEPYRLKLAY
VQQRLENTRDRNWRLYKGDELQREREALSEHPGMTGLYRSGAEFLTELKLIEHNLVETGL
SCRDLENLICQVEIYGFNLAYLDIRQESTVHSDALREIAEYLQILPKSYNQMSECDRVIW
LATELQTRRPLIPAELPFSPKTCETINTFRVLRQMQQEFGPEICQTYVISMSHDVSDLLA
VLLLAKEAGLYDPATGISNIQVVPLFETVEDLKKAPEVMEKIFDLPLYRALLAGGYAQEI
AEKTEENIQCPIENIKLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQMVAEKHGVELRI
FHGRGGSVGRGGGPAYKAILAQPGKSISGRIKITEQGEVLASKYSLPELALYNLETVATA
VIQASLLHTGFDGIDPWNEIMEELSARSRSHYRHLIYEQPDLVDFFHQVTPIQEISQLQI
SSRPARRGGKKDISGLRAIPWVFSWTQSRFLLPSWYGVGTALQEFLLEEPEEHMKLLQYF
YLKWPFFRMVISKVEMTLSKVDLQIAEHYVRELALPADKERFQTLFEQIAAEFHLIRGLV
LTITGHQRLLDEDPSLQRSVQLRNATIVPLGLLQVSLLKRLRQHGSSGIPGVIHSRYSKG
ELLRGALLTINGIAAGMRNTG
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagtcctccagtcttcagaacaggctattgatgcaacatctatttcccattct
cccgcttactcaaaatctgacctgtttctgcgaaatcgcctcaaagtagtagaggacttg
tgggaatcggtgctgcgacaggagtgcgggcaggaattggtggatttgctccaacaaatg
cgatcggtcaattccgccgagggacaagccactcactttcgcgagtcgaatgtcgtacag
ctaatcgaaaagctcgacctcaacgccgccatccgcgcggctagggcttttgcactgtat
tttcagttgatcaacattgtcgaacagcactacgaacagcgagaccaacagctagcttac
gctagcagcaacgatgctggtgggcggatgttttctaagctgccaggacaagcaatggat
gcccccgatcgcccgcgccacagggaaggcccaggccccgcccaaatggctctgaacaag
gcagacagcagcgagacgatcgcccgagatgccggcacttttcaccaacttttcccgatg
ctgctgcgcttgaacgtgccaagccagcaaatccagcgcttgatcgatcagttagacatc
cgcttggtattcaccgctcaccccacggaaattgtccgtcacacgatccgcaccaagcag
cggcgaatggcgaagattctccaacagctagaccaagttgacgagaaatttcaggtgatc
ggggccgaatctccaagcccgtacccggtgtcttgctgggaagcggcggctctccaagag
caactgatggaagaaattcgcctctggtggcgcactgacgaactgcaccagttcaagccc
actgtgctcgacgaggtggaatacactctccactacttcgaggaagttctgtttgatgct
attcccgaactctaccaccgcttaaagcaagctctgcacgcttcttacccttatctgaaa
ccgcctagttacaatttttgcaagttcggttcttgggtgggatcggacagggacggcaac
ccttctgtgactccgaaagttacttggcaaactgcttgctatcagcgccacttagtgctg
cagaagtacatcagcgcggtgaagcggctgaacgaacttttgagtttgtcgctgcactgg
agcgacgtgctgccggaattgctggaatctctcgatcgcgacaaatcggaattcccggat
gtttacgagcaatgggcaatccgctatcggcaagaaccttatcggttgaagctggcttac
gtgcagcagcgactggaaaatacgcgcgatcgcaattggcggctctacaaaggagacgag
ttgcagcgggagcgcgaagctttgtcagaacatcccggaatgaccggcctttatcgatcg
ggcgctgagtttttgaccgaactcaagctcatcgagcacaatttagtggaaacaggtttg
agctgtcgggacttggaaaatctgatctgccaagtagaaatttacgggtttaatttggct
tacctagatattcgccaagagtcaactgtacactcggacgctttgagggaaattgctgaa
tacttgcaaattttgcccaagtcttacaatcaaatgtcggaatgcgatcgagttatttgg
ctggcaacagaactgcaaactcgccgccctttaattccagcagaattgcccttttctccc
aaaacttgcgagacgatcaataccttccgggtattgcggcaaatgcagcaggagtttggc
ccggaaatttgccaaacttacgtcatcagcatgagccacgatgtcagcgatttactggcg
gttttgctgttagcaaaagaagcgggactttacgatccggcaacaggaattagcaacatt
caagtagttcccctgtttgaaacggtggaagatttgaaaaaagcgccggaagtaatggaa
aaaatcttcgatctgccactttatcgagctttgctagcaggaggatacgcgcaggaaata
gcggaaaaaaccgaagaaaatatccaatgtccaatcgaaaatatcaaattgcaagaggtg
atgctggggtattcggacagcaataaagattctggtttcctcagcagcaattgggaaatc
cacaaagctcaaaaggctttgcaaatggttgcggaaaaacacggtgtggagttgcggatt
tttcacggcagaggcggttctgtagggcgcggcggcgggcctgcttacaaggcaattttg
gctcagcctggaaagagtattagcgggcgcattaagattactgaacaaggcgaggttttg
gcttctaaatattctttgccggagttggcgctttacaatctggaaactgtggcgacggcg
gtaattcaagctagtttgctgcacactggttttgatggcatcgacccttggaatgagatt
atggaggagttgtcggcgcgatcgcgatcgcactaccgccatttaatctacgaacagccg
gatttagttgatttcttccaccaagttaccccgattcaagaaatcagccagttgcaaatt
agttctcgtcccgcccggcgcggcggcaaaaaagacatcagcggtttgcgagcaattccg
tgggtgtttagctggactcaaagccgctttttacttccttcttggtacggtgtcggcaca
gctttgcaagagtttttgctggaggaaccggaagagcacatgaaacttttgcagtatttc
tacttgaaatggccattttttagaatggtaatttctaaggtggaaatgaccttatctaag
gtggatttgcagattgcagaacactatgtgcgggagttagctttgccggctgacaaggag
cgttttcagactttattcgagcaaattgctgcggaatttcacttgattcggggtttggtt
ttaactattaccggacaccagcgtttgttggacgaagatccgtcgctgcagcgttcggtg
cagttgcgaaatgcgacgattgtacctttgggtttgttgcaggtttcgctgctgaaacgc
ttgcggcagcacggtagtagcgggattccgggggtgattcactcgcgttacagcaagggt
gaattgttgcggggagctctgctgacgattaatggtattgctgcggggatgcggaatacc
ggctag

DBGET integrated database retrieval system