KEGG   Oscillatoria nigro-viridis: Osc7112_0632Help
Entry
Osc7112_0632      CDS       T02375                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oni  Oscillatoria nigro-viridis
Brite
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Osc7112_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(730905..731660)
Genome map
AA seq 251 aa AA seqDB search
MTLKRRDFLYLVTATVGAITAGACQASGNNVSQASPIAESPKIAQTPGPFTLPPLPYEYN
ALEPHIDARTMQFHHDKHHAAYVKNLNDAVSKYPQLKNITAENMLRDLSKVPEDIRTAVR
NNGGGHLNHSMFWEIMSPKGGGEPTGAIATAIKQTFGSVDDFKAKFNDAGAKRFGSGWVW
LVRNKAGKLEITTTANQDTPLIDGNYPIMGNDVWEHAYYLKYQNLRADYLKAWWNVVNWA
EINKRYEKAIG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaaacgccgagatttcttgtatttggtgactgccaccgtcggagctattacc
gcaggtgcttgccaagcgtcaggaaataatgtatcgcaagcaagtccaattgcagaaagc
ccaaaaatagcccaaactccggggccttttacacttccgcctttgccctacgaatacaat
gctttagaaccgcacatcgatgcgcggacaatgcaatttcaccacgacaaacaccacgcc
gcctacgttaaaaacctcaacgatgctgtcagtaaatacccgcaactcaaaaatatcact
gcggaaaatatgctgcgagatttgagcaaagtgccggaagatattcgcacagcagttcgt
aacaatggcgggggacacctaaatcacagtatgttttgggaaatcatgagtcccaaaggt
ggcggcgaaccgacaggggcaattgcaacagcaattaagcaaactttcggcagtgttgac
gattttaaagcaaaatttaacgatgcaggcgccaagcgttttggcagcggttgggtgtgg
ctagtccgcaataaagctggcaaacttgagattacaactacggcaaatcaagacactcct
ttgatagatggcaactatccaattatgggtaacgatgtttgggaacacgcttattatctc
aaatatcaaaacctgcgcgcagactacttaaaagcttggtggaatgtggttaattgggcg
gaaattaacaagcgctacgaaaaggcgatcgggtag

DBGET integrated database retrieval system