KEGG   Oscillatoria nigro-viridis: Osc7112_5803Help
Entry
Osc7112_5803      CDS       T02375                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Osc7112_5803
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Osc7112_5803
Enzymes [BR:oni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Osc7112_5803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6951541..6952971
Genome map
AA seq 476 aa AA seqDB search
MAYAQTQTQSKAGYKAGVQDYKLTYYTPDYTPKDTDVLAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICFIAYPLDLFEEGSVTNLLTS
LVGNVFGFKALRALRLEDLRIPIAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYEVLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETGEVKGHY
LNVTAPTCEEMMERAEFAKEIKTPIIMHDYLTGGFTANTSLAKWCRRNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHIEQDRA
RGIYFTQDWASMPGVMPVASGGIHIWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLMREGGDIIREACRWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgcaaacccaaactcaatcaaaggctgggtataaagccggagttcaagac
tataaactaacgtattacacgccggactacaccccaaaggatacagatgttttggcggct
ttccgggtaacaccgcagccgggagttcccccagaagaagcaggcgctgctgtggctgct
gaatcttctacaggtacatggacgactgtttggactgacctcctgaccgacctcgaccgc
tacaaaggtcgctgctacgacatcgagccagttcccggtgaagacaaccaatacatctgc
ttcattgcttatcctttggatttgtttgaagaaggttcagtcaccaacttgctgacctcg
ttggtcggtaacgtgttcggtttcaaagctctgcgcgctctgcggttggaagacttgcgg
attcccattgcttacctgaaaaccttccaaggccctcctcacggtattaccgtcgagcgg
gacaaattgaacaagtacggtcgtcctttgctgggctgtacaattaagcccaaattgggt
ctgtctgctaagaactacggtcgtgccgtttacgaagttctgcgcggcggtttggacttc
accaaagacgacgaaaacatcaactcgcagccgttcatgcgctggcgcgatcgtttcttg
ttcgttcaagaagctattgaaaaagctcaagcagaaaccggcgaagtcaagggccactac
ctcaacgtaaccgcccccacctgcgaagaaatgatggagcgggctgagttcgctaaggaa
atcaaaacccccatcatcatgcacgactacctgaccggtggtttcactgcaaacaccagc
ttggccaaatggtgccgccgcaacggtgtgttgctgcacatccaccgcgccatgcacgcc
gtgatcgaccgtcagaagaaccacggtatccacttccgcgtacttgccaagtgcttgcgg
atgtccggcggcgaccacctgcactccggtacagttgtgggcaaactcgaaggcgaaaaa
ggcatcacgatgggcttcgtagacttgatgcgcgaagaccacatcgaacaagaccgcgct
cgcggtatctacttcacccaagattgggcttccatgcccggtgtcatgccggttgcttcc
ggcggtatccacatctggcacatgcctgctttggtggaaattttcggcgacgactcctgc
ttgcagtttggtggcggtaccttgggacacccttggggtaacgcacctggtgcaactgct
aaccgcgttgctttggaagcttgcgtccaagctcgtaacgaaggtcgcaacctgatgcgc
gaaggcggagacattatccgcgaagcttgccgttggagccctgaattggccgttgcttgc
gaactgtggaaagaaatcaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system