KEGG   Orcinus orca (killer whale): 101275448Help
Entry
101275448         CDS       T05247                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2 isoform X1
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
oor  Orcinus orca (killer whale)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oor00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101275448 (SETDB2)
Enzymes [BR:oor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101275448 (SETDB2)
Chromosome [BR:oor03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101275448 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101275448 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 988 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKRKIKDGSATNKEYIQAMILVKEAT
INNNSTLIRDHTSVTQNAQENKSSSLPSTSHEDSFPEDYTSLSTENKEIPPLENKVADFR
EKESSSNLSYQKHDCSSACLMKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNMEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPRQEEIVSDTDISNGVES
VPISFCNEIDNRKLPQFKYRKTMWPRAYYLNSFSNMFTDSCDCKKSCIDITKCACLQLTA
RNAKTCPLLSSKITTGYKYKRLQRQIPTGIYECSLLCKCNRRMCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNTENSDAIDENGKEENIMKNMFSKKRKI
EVADCEVEVIPLELETYPRSAVTEECPPKLHNNPKEPIIEMKCNNISRIQYHSVIRSPKT
KTASIQHNGEKMGFTSSESVTSEDNGGFKPTQVHLNSKAKEMRAKKDSSSNQAEDSEDNP
VIESDVIDITKCREETPPGGRCHQTVTLDDQNEIQIQKPQEEKSPACQNQQVFCDKELPS
ETKNASSDSLKKFNKGSVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVAF
FTNRYVKARTELTWDYGYEAGTMPEKEIFCQCGFNKCVFQVAERLQKRICALCPKDLECS
VLYFAQSENIAAHENCLLYSSALVECEDHDPFNHDRNFDVESVKKEVKRGRKLKCTFCGK
AGATVGCDLKSCLKNYHFFCAKSDHAVLQADGSKGTYRVLCQQHADLQNGKSMKFSVVGV
KSKRGRKKHLSTGNPVQPPERMELDRKEKDGRHTDAIVKVPFLKKCKEAGLLNALFEEIV
DKLHLIHERLRDDTTSESDYEEIGTSLFDCRLFEDAFVNIQAAIENKIHLSEQRQQQLKD
EIELLQGLKQTLCSELQSSSTSDSSLSS
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctagaagatgatgggaaa
gtggatttcatatttgaacaagtgcaaaatgtgctgcagtcactgaaacgaaagatcaaa
gatggatctgccacaaataaagaatacatccaagcaatgattctagtgaaggaagcaact
ataaataataattcaactttgataagggatcatacgtctgtgacccagaatgcacaggaa
aacaaatcaagttcattgccctctacatcacatgaagactcctttccagaagactatacc
tctctatctacagaaaataaggaaattccccctctggaaaataaagttgcagactttaga
gaaaaagaatcatcttcaaatttatcttaccaaaagcatgactgctctagtgcctgtctg
atgaaaatgccacttaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccacgtgagttataaa
accccttgtggaaggagtctacgaaacatggaggaagtttttcgttacctgcttgagaca
gagtgtaactttctatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaggcaagaagaaattgtttctgatacggatattagcaatggagtggaatca
gtgcccatttctttctgtaatgaaattgacaatagaaagcttccacagtttaagtacaga
aagactatgtggccacgagcatattatttaaacagcttttccaacatgtttactgattct
tgtgactgtaaaaaaagctgcatagacataacaaaatgtgcatgtcttcaactgacagcg
aggaatgccaagacttgccccttgttaagtagtaaaataaccactggatataaatataaa
agactacagagacagatacctactggcatttatgaatgcagcctgttgtgcaaatgtaat
cgacgaatgtgtcaaaaccgagttgtccaacatggacctcaagtgaggctacaagtattc
aaaactgagaagaagggatggggagtacgctgcctagatgacattgacagagggacgttt
gtttgcatctattcaggaagattactaagcagatctaacactgagaattctgatgctatt
gatgaaaatggaaaagaagagaatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccattagaactggagacatatcctagaagt
gctgtgactgaggagtgtccacctaagctccataataatcccaaagagcccattatagaa
atgaaatgtaacaatatttcaagaattcagtatcattcagtcattagaagtcctaaaacc
aagacggccagtattcaacacaatggggaaaagatgggatttacttcctcagagtctgtc
acctcagaagataatggtggatttaaaccaactcaagtacatctgaactctaaagccaag
gaaatgagagcaaaaaaggactcaagctcaaaccaagctgaagattctgaagacaaccct
gtgattgaatcagatgtgatagatataactaaatgtagagaagaaactccaccagggggc
agatgtcaccaaacagtcacactggatgatcagaatgagattcaaatacaaaagccccaa
gaggaaaaatctccagcatgtcaaaaccagcaggtcttttgtgataaagagttaccaagt
gaaaccaagaatgcttcatctgattctctaaagaagttcaataaagggagtgtgttttta
ttggatgccacaaaagaaggaaatgtgggccgcttccttaatcatagttgttgcccaaat
cttttggtacagaatgtttttgtagaaacacatgacagaaattttccattggtggcgttc
ttcaccaacaggtatgtgaaagcaagaacagaactaacgtgggattatggttatgaagct
gggactatgcctgaaaaagaaatattctgccaatgtgggtttaataagtgtgtctttcag
gttgcagaaaggttgcaaaaaaggatatgcgcactttgccccaaagacctcgagtgtagt
gtcctgtactttgcacagtcagagaatatagctgctcatgaaaactgtttgctgtattcc
tccgcgcttgtggaatgtgaggatcatgatccgttcaatcatgatagaaattttgatgtg
gaatcggtaaagaaagaagtcaagagaggaaggaagttgaaatgcacattttgtgggaaa
gcaggagccaccgtgggatgtgatttaaaatcctgtctcaagaattaccactttttctgt
gccaagagtgaccatgcagttctacaagctgatggatctaaaggaacttacagagtattg
tgccaacaacatgctgaccttcaaaatggtaagtctatgaaatttagtgttgtgggagtg
aaaagtaaaagggggaggaaaaaacatctctcaacaggcaatcctgtacagccaccggaa
agaatggaattggataggaaggaaaaggatggcagacacacagatgcaattgtgaaagtt
ccttttcttaagaaatgtaaagaagcgggtcttcttaatgctttatttgaagaaatagta
gacaaacttcatttgattcacgaaagactcagggatgacaccacttcagaatcagactat
gaagaaattgggacttcactttttgactgcagattgtttgaagatgcatttgtaaatatt
caagcagcaatagagaataaaattcatctatctgaacaaaggcagcagcagctgaaggac
gagattgagctacttcagggcttaaaacaaaccttgtgctctgagcttcagtcaagttct
acttcagattcttctctgtcttcttaa

DBGET integrated database retrieval system