KEGG   Orcinus orca (killer whale): 101276250Help
Entry
101276250         CDS       T05247                                 

Gene name
PCSK2
Definition
(RefSeq) neuroendocrine convertase 2 isoform X1
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
oor  Orcinus orca (killer whale)
Brite
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101276250 (PCSK2)
Peptidases [BR:oor01002]
 Serine Peptidases
  Family S8: subtilisin family
   101276250 (PCSK2)
Chaperones and folding catalysts [BR:oor03110]
 Intramolecular chaperones
  Subtilisin family
   101276250 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 101276250
NCBI-ProteinID: XP_004270441
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MKGGCVFQWKAAAGLLFCVMVFASAERPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLPHHHQLERDPRVKRALQQEGFNRKKRGYRDINEIYIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVANNNICGVGVAYGSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
PTGKLVLKLTTAACEGKENFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDAKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSVPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILGEN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggctgtgtcttccagtggaaggcggccgccgggctcctcttctgtgtcatg
gtttttgcatctgccgagagaccggtcttcacgaatcattttcttgtggagttgcataaa
ggaggagaggaagaagctcgccaagttgcagcagaacacggttttggagtccgaaagctc
ccctttgctgaaggcctgtatcatttttatcacaatggcctggcaaaggccaagaggaga
cgcagcctgccccatcatcatcagctggagagagaccccagggtaaagagggccttgcaa
caggaagggttcaaccgaaaaaagcgagggtatagagacatcaacgagatctacatcaac
atgaacgaccctctttttacgaagcagtggtatctgatcaataccgggcaagctgatggt
actcctggcctcgacttgaatgtggcagaagcctgggagctgggatacacagggaaaggt
gttaccattggaattatggacgatgggatcgactatctccacccggacctggcctcaaac
tataacgccgaagcaagctacgacttcagcagcaacgacccctatccttaccctcgatac
acagatgactggtttaacagccatgggacccgatgtgccggggaagtttctgcagtcgcc
aacaacaacatctgcggggtcggagtggcctacggctccaaggtcgcagggatccggatg
ctggaccagcccttcatgacggacattatcgaggcctcctccatcagccacatgcctcag
ctgatagacatttacagcgccagttggggccccaccgacaacgggaagacggtggatggg
ccccgggagctcacactccaggcgatggcggacggcgtgaacaagggccgagggggcaaa
ggcagcatctacgtgtgggcctcaggggacggcggcagctacgacgactgcaactgcgac
ggctacgcctcgagcatgtggaccatctccatcaactcggccatcaacgacggcaggacc
gccctgtacgatgagagctgctcctccaccctggcctccaccttcagcaacgggcgcaag
cgcaaccccgaggccggagtggcaaccacagatttgtacggcaactgcaccctgaggcat
tctgggacatccgcagctgctccggaggcagctggagtgtttgcactggctttagaggct
aacctgggtctgacctggagagacatgcagcatctgaccgtgctcacctccaaacggaac
cagcttcacgacgaggtccatcagtggcggaggaacggggtcggcttggagtttaatcac
ctctttggctacggggtgcttgacgcaggcgccatggtgaaaatggccaaagactggaaa
actgtgcctgagaggttccactgtgtgggaggctccgtgcaggaccctgagaaaataccg
ccgaccggcaagctcgtgctgaagctcaccaccgccgcctgcgaggggaaggagaacttc
gtgcgctacctggagcacgtgcaagctgtcgtcacggtcaacgcgaccaggcgaggggac
ctgaacatcaacatgacgtcccccatgggcaccaagtccatcctgctgagccggcggcca
cgggacgacgacgccaaggtgggcttcgacaagtggcctttcatgaccacccacacctgg
ggggaagatgcccgggggacatggaccctggagctgggcttcgtggggagcgtgccccaa
aagggggtgctgaaggagtggacactgatgctccacggcacgcagagcgccccgtacatc
gaccaggtggttagggattaccagtccaagctggccatgtccaagaaggaggagctggag
gaagagctggacgaagcggtggagagaagcctgaagagcatcctgggcgagaactag

DBGET integrated database retrieval system