KEGG   Orcinus orca (killer whale): 101278172Help
Entry
101278172         CDS       T05247                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X1
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor05034  Alcoholism
oor05165  Human papillomavirus infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101278172 (HDAC7)
  Substance dependence
   05034 Alcoholism
    101278172 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    101278172 (HDAC7)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101278172 (HDAC7)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101278172 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101278172
NCBI-ProteinID: XP_012390132
LinkDB All DBs
Position
Unknown
AA seq 1030 aa AA seqDB search
MHSPGADGTQVSPGAHCPSPPGTGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLA
LQHPQRLHHHLFLAGLQTQRSAETMRVKIELPKHAVASSSDPAPLPPFSLPRPSPPSPTP
RPSLGGRPSPQLSMDTPLPELQVGQQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKK
QQAALERTVHPNSPSVPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSE
PNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSE
HGPNPVLGSEALLGQRLRLQETSLAPFALLPTITLGLPAPARADGDRRTHATLGPRGPVL
ASPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHAPLLTVPGLGPLPFHFAQSLLTT
ERPSGSGLHRPLSRTRSEPLPPSATAPPLLGPLQPRLERLKPHVQLMKRPAKPSEKPRLQ
QIPSAEDLETDGGGVGPLGDDGLEHRESSHGQHEARGPVPLQQHQQVYLWEQQRLAGRLP
RGATGDSVLPPLAQGGHRPLSRAQSSPAAPASLPTPEPTSQARVLPSSETPARTLPFTTG
LVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLERGLRSQCESLRGRKASLEELQSVH
SERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWA
AGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKI
LIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAW
AGGLDPPVGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPPPLGGYHVSAKCFG
YMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAI
RSLEAVIRVHSEYWGCMQRLASCPDSWVPRVPGADAEVEAVTALASLSVGILTEERTSEQ
LVEEEEPMNL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactgccccagtccc
cctggcacaggctgccccaggccctgcgcagacacgccaggccctcagccccagcccatg
gacctgcgggtgggccagcggcccccggtggagcccccgccggagcccacgctgctggcc
ctgcagcacccccagcgcctgcaccaccacctcttcctggctggcctgcagacccagcgc
tcggcggagaccatgagggtaaagatagagctccccaagcacgcagtggcctcgagctca
gacccggcacccctccctcccttcagcctccccagaccctcgcctccgtctccaactcct
cgcccctccctgggcggccggccctccccacagctctcaatggacacgccgttgcccgag
ttgcaggtggggcagcaggagcaggagctgcggcagcttctcaataaggacaagagcaag
cgcagtgccgtagccagcagtgtggtcaagcagaagctggcagaggtgattctgaagaaa
cagcaggcagccttagagaggacggtccatcccaatagccccagcgttccctacagaact
cttgagcccttggagacggaaggagctgcccgttccatgctcagcagcttcctgcctcct
gtacccagcctgcccagcgaccccccagaacacttccctctgcgtaagacagtctctgag
cccaacctgaagctgcgctacaagcccaaaaagtccctggagcggaggaagaacccgctg
ctgcggaaggagagcgccccgcccagcctccggcggcggccggcagagaccctcggcgac
tcctcccccagtagtagcagcacgccggcgtcagggtgcagctcccccaatgacagcgag
cacggccccaacccggtcctgggctccgaggcgctcttgggccagcggctgcggctgcag
gagacctctctggctccgttcgccttgctgcccacaatcacgctggggctgcctgcccct
gccagggctgatggtgaccgcaggacccatgcgactctgggccctcggggaccagtcctg
gcgagtccccatgctcccctcttcctgccccatggcctggagcccgaggctggaggcccc
ctgccctctcgcctgcagcccattctcctcctggatccttcggtctctcacgcccccctg
ctgactgtgcccgggcttgggcccctgcccttccactttgcccagtccttactgaccacc
gagcggccctccgggtcaggcctccaccggccgctgagccggacccgctcagagcccctg
cccccaagcgccactgcccccccactgctgggtcccctgcagccccgcctggagcggctc
aaacctcatgtccagctgatgaagaggccagccaagccgagtgagaagccccgactgcag
cagataccctcggctgaggacctcgagacagatggcgggggcgtggggccgctgggggat
gacggcctggagcacagggagtccagccatgggcagcatgaggcccgaggccctgttcct
ctccagcagcaccagcaggtgtacctctgggagcagcagcgactggctgggcggctcccc
cggggagccactggggactccgtgctgcctcccctggcccagggcggtcaccggcctctg
tccagggctcagtcttccccagccgcgcctgcctccctgccaaccccagagcccaccagc
caggcccgtgtcctgcccagctcagagacccctgcccggaccctgcccttcaccacaggg
ctggtctatgactcagtaatgctgaagcaccagtgctcctgcggagacaacagccggcac
ccggagcacgcaggccgcatccagagcatctggtcccggctgctggagcgggggctccgg
agccagtgcgagtctctacggggccggaaggcctccctggaggagctgcagtcagtgcac
tcggagaggcacgtgctcctctacggcaccaacccgctcagccgcctcaaactggacaat
gggaagctggcagggctcctggcacagcggatgttcgtgatgctgccctgcggtggcgtt
ggggtggataccgacaccatctggaacgagctgcactcctccaacgcggcccgctgggct
gccggcagcgtcactgacctcgccttcaaagtggcttcccgagagctaaagaacggtttt
gctgtggttcggcccccaggacaccatgcagaccattccacagccatgggcttctgcttc
ttcaactcagtggccatcgcctgccggcagctgcaacaacagggcaaggccagcaagatc
ctcatcgtggactgggacgttcaccatggcaacggcacacagcagaccttctaccaggac
cccagcgtgctctacatctcccttcatcgccacgacgatggcaacttcttcccaggcagt
ggggctgtggatgaggtgggagctggcagcggtgagggcttcaatgtcaatgtggcctgg
gctggaggtctggaccccccagtgggggatcctgagtacctggccgccttcaggatagtc
gtgatgcccatcgcccgggagttctctccggacctggtcctggtgtcagctgggtttgat
gctgccgagggtcacccacccccactgggcggctaccacgtttccgccaaatgttttggg
tacatgacgcagcagctgatgagcctggcgggaggcgcggtggtgctggccttggagggt
ggccacgatctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctaggc
aacaaggtggatcccctctcagaagaaggctggaaacagaaacccaacctcaatgccatc
cgctctctggaagctgtgatccgggtgcacagtgaatactggggctgcatgcagcgcctg
gcctcctgtccagactcctgggtgcccagggtgccaggggccgatgcagaagtggaggca
gtaactgcactggcatccctctccgtgggcatcctgactgaagagcggacctcagagcag
ctggtggaggaggaagaacccatgaatctttag

DBGET integrated database retrieval system