KEGG   Orcinus orca (killer whale): 101280364Help
Entry
101280364         CDS       T05247                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
oor  Orcinus orca (killer whale)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oor00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101280364 (SETD2)
Enzymes [BR:oor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101280364 (SETD2)
Chromosome [BR:oor03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101280364 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2533 aa AA seqDB search
MKQLPPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGSEKQNDTPNSPVVPLQVDSTPKIKMDI
GDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTSTTAVASPSPPIVPLPAVIAES
TTVDSPPSSPPPPPPPPQATTPSLPAPITEPVALPHTPVTVLMTAPVDVAARALKEPPVT
IVPESSEVDTKQDPVSNSSEEHITHNLNEQADIPSQKEDSHIGKEEEIPDSSKSSLGSKK
TGSKKKSSQSEGTFLGSESDEDSVRTSSSQRSHDLKFSANIEKERDSKKSLATLKSEDLG
KSSRSKTEREDKYFSYSKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSSSYSRSER
SHYYDSDRRYHRSSPYRERARYSRPYTDNRARESSDSEDEYKKTYSRRTSSHSSSYRDLR
TPSSYSKSDRDCKTESSYLEMEKRGKYSSKLERESKRTSENEAMKRCCSPTNELGFRRGS
SYSKHGNSASRYKSAPSKPAPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSELRMI
SKVTEREKIGSPSPSNRLNDSPTFKKLDESPVFKSEFIGHDSHDSIKELDSLCKVKNDQL
RSYCPTEFNINGSPGAESDLATFCTSKRDTVLMSSDDSVTGSEVSPLVKTCMLSSNGFQN
INRCKEKDLDDTRMQHSKSESPFRETEPPVSPHQDQLISLPVMTIDYSKTVVKEPVDVRV
SCCKTKDSDIYCTSNDSRPSLCHSGAENTEPLVTKISSNSFMNMHLKSKTVICDNGSLTD
QHSKFACGEYKQSVGSTSSASINHFDDLYQPTGSSCIASSLQSLPPGIKVDSLTLLQCGE
NTSSVLDAVLKSKSSEFLKHAEKEIIEVGSGLPDSGRGFASWENRHNNGLSGKCVQEAQE
EGNSILPDRRGRPEISLDEEGGRGHAHTSDDSEVVFSSCDLNLIMEDSDGVTYTLKCDSS
GHASEIVSTVHEDYSGSSKSSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETS
PCSSRSSQSYRHYSDHWEDERLEPRRHSYEEKFESIASKACPQTEKFFFHKATEKNSEIS
FIQPSRKQIDNHMSEIAHPQSDGVDSTSHTDIKSDPLGHPNSEEAVKARITSRQQEELPV
YSSDDFEDVSSKSRQQTTFPNRPDSRLGKTESNFSSCEISRVDGFRSSEELRNLGWDFSQ
QEKPTTTYQQPDSSYGACGGHKYQQSAEQYSGTCNYWQGNGYWDPRSAGRLPGTGVVYDR
IQGQVPDSLTDDREEEENWDQRGGSHFSSQSNKFFLSLQKDKGSVQAPEISSNSIKDSLA
VNEKKDLLKNLEKNDMKDRVEQGETAVPLGSALVGPSCVMEDFRDPQRWKECAKQGKMPC
YFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSS
RCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKA
RVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFF
TTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRK
KDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFL
ERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTK
TAVPQLSEGDGYSSENTSRAHTPLNTPDPSTKLSIEADTDTPKKLMFRRLKIISENSMDS
AISDATSELEGKDGKEDLDQLENVPIEEEEELQSQQLLTQQLPESKVDSEIAVEAIKLPT
SEPEADTEIEPKESNGTKLDEPIAEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATK
LLDSWKDLKEVYRIPKKSQTEKESTITERGRDAVGFRDQTVAPKTPNRSRERDPDKQTQN
KEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQ
REAQKQQQQMQNLGMTSPLPYDSLGYSAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPT
PSMDPVCSPAPYDHSQPLVGHSTEPLAAPPPVPVVPHVAAPVEVSSSQYVAQSDGVVHQD
SSVTVLPVPAPGPVQGQNYGVWDSNQQSVSVQQQYSPAQSQATIYYQGQACPTVYGVTSP
YSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPATAVTTIVAPGQPQPLQPPEMVV
TNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASL
EHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRK
PDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKF
GAVYKPKEDTELE
NT seq 7602 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgccgcagccgcctccgaagatgggggatttctacgaccccgagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttc
atcaaaggaccaatgttcaaaggtgttgcttctagtcggtttttgcccaaaggcaccaag
acaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaacaggtttctgacggcacttggcagtgaaaagcaaaatgatact
ccaaattccccagttgtacctcttcaagtagactcgacccctaaaattaaaatggacatt
ggagatacattatctactacagaagaatcttccccaccaaaatcaagggtagaattgggc
aaaatccattttaagaaacatctgcttcatgtaacatccaggccactgctgacttctacc
acagcagtggcatctccatctcctcccatagtaccattaccagcagtcatagcagaatca
acaactgtagactcgccaccctcatctccacctccaccacctccacctccccaagccaca
acaccctcattaccagcaccaataacagagccagtggccttgccacacacaccagtgaca
gttctgatgacagcaccagtagatgtagctgctagagcgttgaaggaaccaccagttaca
attgtaccagaatcatcagaagtggacactaagcaggaccctgtgtctaatagttcagaa
gaacacataactcacaatttgaatgagcaagcagatattccttcacaaaaagaagattcc
catattgggaaggaagaagaaattccagatagttctaagagtagtctgggctctaaaaaa
acaggttctaagaagaaatcctcacaatctgaaggcacctttcttggttcagaatctgat
gaagattctgtacggacttcctcaagtcaaagatcacatgatttaaaattttcagccaac
attgaaaaagaaagagattcaaaaaagagcttagcaactttaaaaagtgaggatttaggg
aaatcttcacgatctaaaacagagagagaggataaatattttagctactcaaaacttgaa
agagatactcgttatatatcttctcgctgtagatcagagagagagcgaaggcggagcagg
tctcgttctaggtctgacagaggttctagaactagttcatcctattctcggtcagaacga
tcccattattatgactctgatcgtcgctaccataggagttccccttatcgagagagggca
cgctattctcggccatatacagataacagggcaagagaaagttctgactcagaagatgag
tataagaagacatactcaaggcgcacctcatctcattcttcctcttacagagacctaagg
acaccatcctcctattctaaatctgatcgagactgtaaaactgagtcctcttatttagag
atggagaagagaggaaagtattcctcaaaattagaaagagaatccaaaaggacttcagaa
aatgaagcaatgaaaagatgttgttctcccactaatgaactgggattccgacgggggtca
tcatattccaagcacggtaacagtgcttcccgttataaatctgccccttcaaaacctgca
cccaagtctgataaatttaaaaattctttctgttgtacagaattgaatgaggaaatcaaa
cagtctcattcttttagtttacagactccttgttcaaaaggtagtgaattaagaatgatt
agtaaagttactgaaagagagaagattgggtctccatctccatcaaatcgattaaatgat
tcacctacttttaaaaagctagatgaatcacctgtttttaagtctgaatttataggacat
gatagccatgatagtattaaggaattagactctttatgtaaagtgaagaatgatcaatta
agaagttattgtcccacagaatttaatataaatggatctcctggggcagaatctgatttg
gcaacattttgcacttctaaacgtgacactgttttgatgtcttctgatgatagtgtgact
ggatcagaggtatcccctttggtcaaaacgtgcatgctttcatcaaatggatttcaaaat
attaatagatgtaaagaaaaagacttggatgatactcgcatgcagcatagtaagtcagaa
agcccatttagagaaacagaacctccagtgtcgccacaccaggatcaactcatatctttg
ccagttatgactatagattactccaaaacagtagttaaagaaccagttgatgtgagagtt
tcttgctgtaaaaccaaagattcagatatatactgtacttcaaacgacagccgcccttct
ttgtgtcattccggagctgaaaatactgagcctttagtaacgaagatttcttcaaatagc
tttatgaacatgcatttgaaatcaaaaacagttatatgtgataatggaagtctgacagat
cagcactcaaaatttgcatgtggagaatataagcagagtgttggtagtactagttcagct
tctattaatcattttgatgatttatatcaacctacagggagctcatgtattgcttcatct
cttcagagtcttccaccaggaataaaagtagacagtttaactctcttgcaatgtggagag
aatacatcttcagttttggatgctgtgctgaagagtaaaagctcagagtttttaaagcat
gcagagaaagaaataatagaagtaggtagtggccttcctgattcaggaagaggatttgct
tcctgggaaaacaggcataataatggactatctgggaaatgtgtgcaagaggctcaagaa
gaagggaattccatactgcctgatagaagaggaagaccagaaatctctttagatgaagaa
ggtggaagaggacatgcacatacttctgatgattcagaagttgtattttcttcttgtgat
ttgaatttaatcatggaggacagtgatggtgtaacatataccttaaaatgtgacagtagt
ggtcatgcctcagagattgtatctactgtccatgaagattattctggttcttccaaaagt
tcaagtgatgaaagtgattcagaagatacagattctgatgatagcagtattccaagaaac
cgtcttcagtctgttgtggttgtgccaaagaattctactttgcccatggaagaaacaagt
ccttgttcttctcggagcagtcaaagttacagacactattctgaccactgggaagatgag
cgattggagccaaggaggcattcatatgaggaaaaatttgagagtatagcaagtaaagcc
tgtcctcaaactgagaagttcttctttcataaagcaacagagaagaattcagaaatttct
tttatacagcccagccgaaaacagatagataatcacatgtctgaaattgctcatcctcag
agtgatggggttgatagtacaagtcatacagacataaaatctgaccctctaggtcatcca
aattctgaggaagcagtgaaagccagaataacttctaggcagcaagaagagctgccagtt
tattcttctgatgattttgaagatgtctcaagtaagtctcggcaacagaccactttccct
aacaggccagatagtagactggggaaaacagagtcaaatttttcttcttgtgagatctcc
cgagtggatggtttccgttcatcagaagagctcagaaatctagggtgggacttctctcaa
caagaaaagcctactaccacatatcagcaacctgacagcagctatggagcctgtggtgga
cacaagtatcagcaaagtgcagaacagtatagtgggacatgtaattactggcaaggcaat
ggctactgggatccaaggtcagcaggtagactgcctggaactggggttgtgtatgatcga
attcaagggcaggtaccagattccttaacagatgaccgtgaagaggaggagaattgggat
caacgtggaggatctcacttttcaagccagtccaataaattttttctgtcccttcagaag
gacaagggatccgtgcaagcacctgaaataagcagcaattccattaaggactctttagct
gtgaatgagaagaaagatcttttgaaaaacttagaaaaaaatgatatgaaagatagagta
gagcagggagagacagcagtgcctctaggctcagcattggttgggccttcctgtgtcatg
gaggacttcagggacccacagcggtggaaggaatgtgccaaacaagggaagatgccttgt
tactttgatctgattgaagaaaatgtttatttaacagaaagaaagaagaataaatcccat
cgggatattaagcgaatgcagtgtgagtgtacacctctttctaaagatgaaagagctcaa
ggtgaaatagcatgtggggaagattgtcttaatcgtctcctcatgattgaatgttcttct
cgttgtccaaatggggattattgttccaatagacggtttcaaagaaaacagcatgcagat
gtggaagtcatactcacagaaaagaaaggctggggcttgagagctgctaaagaccttcct
tcgaacacctttgtcctggaatattgtggagaggtacttgatcataaagagtttaaagcc
cgggtaaaggagtatgcacgaaacaaaaacatccactactatttcatggccctgaagaat
gatgagataatagatgccactcagaaaggaaattgctcccggttcatgaatcacagctgt
gaaccaaactgtgagactcaaaaatggactgtgaatggacaactgagagttgggtttttt
accaccaaactggttccttcaggctcagagttaacatttgactatcagttccaaagatat
gggaaagaagcacagaaatgtttctgtgggtcggctaattgccggggttacctgggagga
gagaacagagtcagcatcagagcagcaggagggaaaatgaagaaagaacgatctcggaag
aaggattcggtggatggagagctagaagccctgatggagaatggtgagggtctctctgat
aaaaaccaggtgctcagcttatcccggctaatggttagaattgaaactttggaacagaaa
cttacctgtctcaagctcatacagaacacacattcacagtcttgcctgaagtcctttctg
gaacgtcatgggctgtctttgttgtggatctggatggcagaactaggtgatggccgggaa
agtaaccagaagcttcaggaagagattataaagactttggaacatttacccattcctact
aaaaatatgttggaggaaagcaaagtacttcctattattcaacgttggtctcaaaccaag
actgctgtccctcagctgagtgaaggagatgggtattctagcgagaatacatcacgtgct
cacacaccgctcaacacacctgatccttccaccaagctgagcatagaagctgatacagac
acccccaagaagctaatgtttcgcagacttaaaattataagtgaaaatagcatggacagt
gcgatctctgatgctaccagtgagctagaaggcaaggatggcaaagaggaccttgaccag
ttagaaaacgtccctatagaagaagaggaagagttacagtcacaacagctactcacacaa
cagctgcctgaatctaaagttgacagtgaaattgctgtggaggccattaagctacccaca
tctgaaccagaggctgacactgaaatagagcctaaagagagcaatggcacaaaactagac
gaacctattgctgaggaaacaccatcccaggatgaagaggagggtgtatctgatgtggag
agtgagaggagccaggaacagccagataaaacagtagatataagtgatttggccaccaag
ctcctggacagttggaaagacctaaaggaggtatatcgaattccaaagaaaagtcaaact
gaaaaggagagcacaataaccgaacgaggaagggatgctgttggcttcagagatcaaaca
gttgccccaaagactcctaacaggtcaagagagagagacccagacaaacaaactcaaaat
aaagagaaaaggaaacgaaggggctccctctcaccaccttcttctgcctatgagcgggga
acaaaaaggccagatgacagatatgatacaccaacttctaaaaagaaagtacgaattaaa
gatcgcaataaactttctacagaggagcgtcgaaagttgtttgagcaggaggtagctcag
cgggaggcccaaaaacaacagcagcagatgcagaacctgggaatgacgtctccactgccc
tatgactctcttggctacagtgcccctcatcacccctttgctggctacccaccaggttac
cccatgcaggcctatgtggatcccagcaatcctaatgctggaaaggtgctcctccccaca
cccagcatggatcctgtgtgttctcctgctccttatgatcattctcagcccttggtggga
cattctacagaaccccttgctgcccctccacctgtgccagtggtgccacatgtggcagcc
cctgtggaagtttccagttcacagtatgtggcccaaagtgatggtgtggtacaccaagac
tctagtgtcaccgtcttgccagtgccagccccaggcccagtccagggacagaattatggt
gtttgggattcaaaccaacagtccgtgagtgtacagcagcagtactctcctgcacagtct
caagcaaccatatattatcaaggacaggcttgtccaactgtttatggtgtgacatcaccc
tactcacagacaactccaccaattgtacagagttatgcccagccaagtcttcagtacatc
cagggacaacagattttcacagctcacccacaaggagtggtggtacagccagccacagcc
gtgactacaatagttgcaccagggcagcctcagcccttacagccacctgaaatggttgtg
acaaataatctcttggatttaccacccccatctcctcccaaaccaaaaaccattgtctta
cctcccaactggaagacagcccgagacccagaagggaagatttactactaccatgtgatc
acaaggcagactcagtgggatcctcctacttgggaaagcccaggagatgatgccagcctt
gagcatgaagctgagatggacctgggaaccccaacatatgatgaaaatcccatgaagacc
tcaaaaaagcctaagacagcagaagcagacacctccagtgagctggctaagaaaagcaaa
gaagtattcagaaaagagatgtcccagttcatcgtccagtgcctgaacccttaccggaaa
cctgactgcaaagtgggaagaattaccacaactgaagatttcaaacacctagctcgcaag
ctgactcacggcgttatgaataaggagctgaagtactgtaagaaccccgaggacctggag
tgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaagtacatgcagaagttt
ggggctgtttacaaacccaaagaggacactgaattagagtga

DBGET integrated database retrieval system