KEGG   Orcinus orca (killer whale): 101284339Help
Entry
101284339         CDS       T05247                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00240  Pyrimidine metabolism
oor00983  Drug metabolism - other enzymes
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101284339 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101284339 (TK1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101284339 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 101284339
NCBI-ProteinID: XP_004275578
LinkDB All DBs
Position
Unknown
AA seq 237 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSNFSTHDRNTMEALPACVLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKASGQPVGLDSKENKENCPVLGKPGEAMGARKLFAPHQILQCSPAN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacttgcccaccgtgctgcccggctcccccagcaagacccgggggcag
atccaggtgattctcggacccatgttctcaggaaaaagtactgagctgatgagaagggtc
cgtcgcttccagattgcccagtacaagtgcctggtgatcaaatatgccaaggatacgcgt
tacagcagcaacttctccacgcatgaccggaacaccatggaggccctgccagcctgcgtg
ctccgggatgtggcccaggaggccctgggcgtggctgttataggcatcgacgaagggcag
tttttccccgacatcgtggagttcagcgagaccatggccaatgccgggaagaccgtcatt
gtggctgcactggatgggaccttccagaggaaggctttcgggaccatcctgaacctggtg
cccctggccgagagtgtggtgaagctgacggcggtgtgcatggagtgcttccgagaggcc
gcctacaccaagaggctgggagtggagaaagaggtcgaggtgataggaggagcagacaag
taccactccgtgtgccgcctctgctacttcaagaaggcctcgggtcagcctgtcgggctg
gacagcaaagagaataaagagaactgcccagtgctgggaaagcccggggaggccatggga
gccaggaagctattcgctcctcatcagatcctgcagtgcagcccggccaactga

DBGET integrated database retrieval system