KEGG   Obesumbacterium proteus: DSM2777_03415Help
Entry
DSM2777_03415     CDS       T04310                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
opo  Obesumbacterium proteus
Pathway
opo00620  Pyruvate metabolism
opo00680  Methane metabolism
opo01100  Metabolic pathways
opo01120  Microbial metabolism in diverse environments
opo01200  Carbon metabolism
Module
opo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:opo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSM2777_03415
  Energy metabolism
   00680 Methane metabolism
    DSM2777_03415
Enzymes [BR:opo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DSM2777_03415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2764
Motif
Other DBs
NCBI-ProteinID: AMO80178
LinkDB All DBs
Position
complement(691480..694116)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDRVETIRKLSKSSRAGNDASRQELLTTL
QNLSNDELLPVARAFSQFLSLTNTAEQYHSISPHGEAASNPEVMAQLFTRLKNNNLSDEQ
IKKAVDDLSIELVLTAHPTEITRRTLIHKLVEVNNCLSQLDHSDLADYERNQIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGYAVVENSLWEGVPAFLREFNEQLENSLGYQLPVEAV
PVRFTAWMGGDRDGNPNVTADITRHALLLSRWKATDLFLRDIAVLVSELSMTECTPELRA
LAGGDDVQEPYRELMKKLRTQLTETQVYLAAKIKGERATRPDNLLVKNEQLWEPLYACYQ
SLKACGMSIIANGQLLDTLRRVHCFGVPLVRMDVRQESTRHSEALAELTRYLGLGDYESW
SEADKQAFLVRELNSKRPLVPRQWEPSAETKEVFDTCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPYALPVAPLFETLDDLNNAEDVMTQLLSIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQEALVNVCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKLGLPQVTISSLSLYTNAILEANLLPPPAPKQEWRDLMDELS
DVSCDMYRGYVRENKDFVPYFRSATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAALQAAVDEGKQSTLETMCRDWPFFSTRIGMLEMVFAKSDLWLAEY
YDQRLVDEKLWPLGKQLRDQLSKDIKVVLTIANDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRSLPEPDANVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaacgtcagtatgctagggaagctgctcggc
gacaccatcaaagaagcgctgggcgagaatatcctagaccgcgtcgagactatccgtaaa
ttatcaaaatcctcacgtgcgggtaacgatgcaagccgtcaggaactgttaacgacgcta
cagaacttgtcgaatgatgagctattgccggttgcccgtgcttttagccaattcctgagt
ctgacaaataccgccgagcaatatcacagcatttcccctcatggcgaagcggcaagcaac
cctgaagtgatggctcaacttttcacccgtttgaaaaacaacaatctcagcgatgagcag
atcaaaaaagccgtagacgatctctccattgagctagtcctcaccgctcatcctactgaa
atcacccgtcgtaccctgattcataaactggttgaggttaacaactgccttagccagctc
gatcacagcgatttggccgactacgaacgcaatcaaatcatgcgtcgcctgcgccagctg
gttgctcaatcatggcataccgatgaaattcgcaagaaccgcccatccccaattgatgaa
gctaaatggggatatgccgtagtggaaaatagcctgtgggaaggggttccggcattctta
cgcgagtttaatgaacagctagaaaactcattgggttaccaactaccggttgaagctgtg
cccgtgcgtttcaccgcatggatgggcggcgaccgcgacggcaacccgaacgtgacggca
gacatcacgcgccacgctttactgttaagccgctggaaagctaccgacctgttcctgcgt
gatatcgccgtgctggtttctgaactgtcgatgacagaatgcacgccagaactgcgcgct
ctagccggtggtgacgacgttcaagagccctaccgtgagctgatgaaaaagctgcgcacg
cagctaactgaaactcaggtttatctggcagcgaaaatcaaaggcgaacgcgcgacgcgc
ccagacaatctgctggtgaaaaacgagcagctttgggagccgttgtacgcctgctaccaa
tcgctcaaagcctgcggcatgagcattatcgccaatggccaactgctggacacgctgcgc
cgcgttcactgcttcggcgtaccgctcgtacgcatggatgttcgtcaagaaagcacgcgt
cactctgaagccttagctgagctcacccgttatttgggcctcggcgattatgaaagctgg
tcagaagctgacaagcaggccttcttggtgcgtgaactcaactccaaacgcccactggtt
ccacgccaatgggagccaagcgctgaaactaaagaagtctttgatacctgccgcgtgatc
gcggaggcacctcagggttctatcgccgcctatgtaatttcgatggcgcgcactccttcc
gacgtgctcgctgttcatctgctattgaaagaagcgggttgcccttacgcattgcctgtt
gctccgctgtttgaaacccttgatgacttgaacaatgccgaagatgtgatgactcagcta
ttgagcatcgattggtatcgcggctttattcagggcaagcagatggtgatgatcggctac
tctgactcagcaaaagatgcgggcgtgatggccgcatcatgggcgcaatatcgtgctcaa
gaagccttggttaacgtgtgtgaaaaagcgggcgtggcattaaccctgttccacggacgc
ggcggttcgatcggtcgcggtggtgcaccggctcatgcggctctgctttcacaaccgccg
ggcagcttgaaaggcggtctgcgtgtcaccgagcaaggcgagatgatccgcttcaaactt
ggtttaccacaggtcactatcagcagtctatcgctgtacaccaacgcgattttggaagct
aacctgctaccaccaccggcaccaaagcaggaatggcgcgatttgatggatgagttgtca
gacgtttcctgcgatatgtatcgtggctatgttcgggaaaataaggacttcgtgccttac
ttccgttctgcgacgcctgagcttgagcttggcaaactgcctttgggttctcgccctgcc
aaacgtaaaccaaacggcggcgtagaaagtctgcgcgccattccatggatcttcgcttgg
acgcaaaaccgcttaatgctgccagcgtggttgggcgcaggtgctgcgctacaggccgcc
gttgatgaaggaaaacagtcaacgctggaaaccatgtgtcgcgactggcctttcttctca
acccgcattgggatgctagaaatggtgtttgcgaagtcagatttatggctggctgaatac
tacgatcagcgcttggttgacgaaaaactgtggccgctaggcaaacagctacgcgatcag
ctatcgaaagatatcaaagtggtgctcaccatcgccaatgacgatcacctgatggaagat
ctgccgtggatcgccgagtctatcgcgctacgcaacgtgtataccgatccattaaacgta
ctgcaggctgaattgttgcaccgttcacgctcgctaccggagccggatgccaacgttgaa
caagcgctgatggtcaccatcgcaggcgttgcagccggtatgcgcaatacaggctaa

DBGET integrated database retrieval system