KEGG   Obesumbacterium proteus: DSM2777_04665Help
Entry
DSM2777_04665     CDS       T04310                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
opo  Obesumbacterium proteus
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:opo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DSM2777_04665 (glpD)
Enzymes [BR:opo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DSM2777_04665 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
971588..973072
Genome map
AA seq 494 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAKDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPSS
KGLRFGPESVLKSSLTRGFEYSDCWVDDARLVLLNAQEVVVRGGEVRTRTQVTRAYRENG
LWVVEAKNADTGEVFTWRAKGLVNATGPWVKHFFDNGLELKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYNGDPHDVKIDDNEVNYLLKVYNDHF
KKQLSKDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDQDGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYDNCGPAWTKNGVLPGGDLGTDRDSYAAQLRRRFTWLPEALARRYVRT
YGTRAEQLIGTAQSLEDLGEHFGHHLYEAELRYLVAEEWVVELDDAIWRRTKLGMWLDDA
QKQRVAQWLAEHKS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggtggcattaacggtgccggtatcgctgcg
gatgcggcaggacgcgggctttccgttctgatgctggaggctaaagatttggcctgcgcc
acgtcatcagcgagctccaaattaatccacggtggcctgcgttatctggagcactatgag
tttcgtttggtgagcgaagccttggcagagcgtgaagttttgctgaaactcgcgccgcat
atcgctttcccgatgcgtttccgcttaccacatcagccacacttgcgcccagcttggatg
atccgtacaggcctgttcctttacgatcatttgggcaaacgtaccagcttgccaagcagc
aaaggcctgcgctttggtcctgaatcggtcttgaaatccagcttaacgcgtgggtttgag
tattcagattgctgggttgatgatgctcgtttggtgctgttaaacgcgcaagaagttgtg
gtgcgcggtggtgaagttcgcactcgcactcaggttactcgcgcctatcgtgaaaatgga
ttgtgggttgttgaagccaaaaatgcagacacgggtgaagtctttacctggcgtgctaaa
ggtctggtgaatgcgaccggcccatgggttaaacatttcttcgataatggattagagctg
aaatcgccttatggtatccgtctgatcaaaggcagccatattgtggttccgcgtgtccat
aatcagccgcaggcttatatcctacagaacgaagatcatcgcattgtctttgtgatcccg
tggatggatgagttttctatcatcgggactaccgacgtggaatataacggcgatccgcat
gatgtgaagattgatgataatgaagtgaattacctgctgaaggtttataacgatcacttc
aagaaacagttgagcaaagacgacatcgtctggacttattccggtgtgcgtccgctgtgt
gacgacgaatcagattctccacaggcgatcacccgtgattatacgctcgacgtgcacgat
caggatggcaaagcgccgctgctttccgtatttggcggtaagctcaccacctatcgcaaa
ctggcggaacatgcgctagagaaactgtctggttattacgataactgcggtcctgcatgg
actaaaaacggtgtattgccggggggcgatttaggcaccgatcgtgatagctatgccgcg
cagctgcgtcgccgctttacgtggttgccggaagcgttagcccgtcgctacgtgcgcact
tacggcactcgcgctgaacaactgattggaaccgcgcaatcgctggaagatctgggcgag
cactttggccatcatctgtatgaggctgagctgcgttatctggttgctgaagagtgggtg
gttgagctggatgatgcgatctggcgccgtactaagttaggtatgtggctggatgatgcc
cagaaacagcgcgttgcgcagtggctggcagagcataagtcataa

DBGET integrated database retrieval system