KEGG   Obesumbacterium proteus: DSM2777_15185Help
Entry
DSM2777_15185     CDS       T04310                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
opo  Obesumbacterium proteus
Pathway
opo00020  Citrate cycle (TCA cycle)
opo00480  Glutathione metabolism
opo01100  Metabolic pathways
opo01110  Biosynthesis of secondary metabolites
opo01120  Microbial metabolism in diverse environments
opo01130  Biosynthesis of antibiotics
opo01200  Carbon metabolism
opo01210  2-Oxocarboxylic acid metabolism
opo01230  Biosynthesis of amino acids
Module
opo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
opo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:opo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DSM2777_15185
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DSM2777_15185
Enzymes [BR:opo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DSM2777_15185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AMO82254
LinkDB All DBs
Position
3194526..3195779
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPVIPFIEGDGIGVDVTPAMIKVVDAAVNKAYKG
ERKISWMEIYTGEKSTQVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFL
RDEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSLTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPKTGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMEWFEAADLIVKGMEGAIAAKTVTYDFERQLEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagttgttgttccggctgaaggtaagaaaattacggttgatgctcagggg
aaactggttgttccgcataacccggtgattccgttcattgaaggtgacggtatcggtgtt
gacgtgactccagcgatgatcaaagtcgttgatgcagccgttaacaaagcctacaaaggc
gaacgcaaaatttcttggatggaaatctacaccggcgagaaatcgactcaggtctacggc
aaagacgtatggctgcctgaagagacgctggaccttattcgtgactaccgcgtggctatc
aaaggcccactgaccactccggttggcggcggtattcgttctcttaacgttgcattgcgc
cagcagctcgacctttacgtttgcctgcgcccagtccgttactatcagggcaccccaagc
ccggtgaaacagccagaattgaccgatatggtgatcttccgtgaaaactcagaagacatc
tacgccggtatcgaatggaaagcagacagcgctgaagctgacaaagtgatcaaattcctg
cgtgatgaaatgggcgtgaagaaaattcgcttccctgagcattgcggtatcggtatcaag
ccttgctcggaagagggcactaagcgtttggttcgcgcggcgattgagtatgcgatcacc
aacgaccgtgactctctgacgctggttcacaaaggcaacatcatgaagttcaccgaaggc
gcattcaaagactggggataccagttagcgcgtgaagaattcggcggcgagctgatcgac
ggcggcccatgggttaaaatcaagaatcctaaaaccggcaaagacatcatcgttaaagat
gtgattgcggatgcgttcctgcaacagatcctgctgcgtcctgctgaatatgacgttatc
gcctgtatgaacctgaacggtgactacatctccgatgcgctggccgcacaggtgggtggt
atcggtattgcaccgggcgctaacatcggtgacgaatgcgcgctgttcgaagcgactcat
ggcaccgcacctaagtatgccggtcaggataaagtgaacccaggttctattatcttgtcc
gctgaaatgatgctgcgccacatggaatggttcgaagcggctgatttaattgttaaaggc
atggaaggcgcaatcgctgccaagaccgtaacctatgacttcgaacgtcagttagaaggc
gctaagctgctgaaatgttcagagtttggtgacgcgattattaaacatatgtaa

DBGET integrated database retrieval system