KEGG   Ochrobactrum pseudogrignonense: A8A54_02750Help
Entry
A8A54_02750       CDS       T04415                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ops  Ochrobactrum pseudogrignonense
Brite
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A8A54_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANG95506
UniProt: A0A1A9FIV1
LinkDB All DBs
Position
1:582456..583163
Genome map
AA seq 235 aa AA seqDB search
MAEQTKPIELYYWPTPNGFKISIMLEELGVPYEVKYVNIGKGDQFQPDFLKIAPNNRMPA
IIDPDGPGGEPISVFESGAILQYLGRKFGKFYPTDERKRVAVDEWLMWQMGGLGPMSGQA
GHFRVYAPEKVQYGIDRYTNEVNRLYGVLNRQLEGKDYIAGEYSIADMASIGWINAYKNY
DQQLEDFPNLKRWYETMNARPAVQRGLLVGKEEREKSNLANDKEAQKILFGQKAR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagacaaaacccattgagctttattattggcctaccccgaatggcttcaaa
atcagcatcatgctggaggaactaggcgttccttacgaagtcaaatatgtgaacatcggt
aagggcgatcaattccagccggactttctcaaaattgcacccaataaccgtatgccagcg
attatcgacccggacgggccgggcggcgagccgatctcggtttttgaatcaggcgcaatt
cttcagtatctcggccgcaagttcggaaaattctatccaacggatgaacgcaagcgtgtc
gccgttgatgaatggctgatgtggcaaatgggtggacttggccccatgtcgggtcaggcc
gggcacttccgcgtttatgcgccggaaaaggtgcaatatggcattgatcgctataccaat
gaggtcaaccgtctttatggtgtcctgaatcgtcaactcgaaggcaaagactatattgca
ggcgaatattctatcgctgacatggccagcattggttggatcaacgcgtacaaaaactat
gatcagcagctggaggatttccctaacctcaagcgctggtatgagaccatgaatgcacga
cctgccgttcagcgtggtctcttggttggcaaggaagagcgcgaaaagtctaacctcgcc
aatgacaaggaagcgcagaaaattcttttcggccagaaggcgcgctaa

DBGET integrated database retrieval system