KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375484Help
Entry
101375484         CDS       T05148                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Leishmaniasis
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101375484 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101375484 (PTGS2)
   04064 NF-kappa B signaling pathway
    101375484 (PTGS2)
   04668 TNF signaling pathway
    101375484 (PTGS2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    101375484 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101375484 (PTGS2)
   04913 Ovarian Steroidogenesis
    101375484 (PTGS2)
   04921 Oxytocin signaling pathway
    101375484 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    101375484 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    101375484 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101375484 (PTGS2)
   05206 MicroRNAs in cancer
    101375484 (PTGS2)
   05204 Chemical carcinogenesis
    101375484 (PTGS2)
   05222 Small cell lung cancer
    101375484 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101375484 (PTGS2)
   05165 Human papillomavirus infection
    101375484 (PTGS2)
   05140 Leishmaniasis
    101375484 (PTGS2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101375484 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MLARALLLFAALALCRAANPCCSNPCQNQGVCMSIGFDQYRCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNVIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYASFEELTGEKEMAAGLEAL
YGDIDAMELYPALLLEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcgcgccctgctgctcttcgccgccctggcgctctgccgtgcagctaatccg
tgctgttccaacccatgtcaaaaccaaggtgtatgtatgagcataggatttgaccagtat
agatgtgactgcactcgaacaggattctatggcgaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcgaaatgtaattatgaaa
tacgtgttgacatccaggtcacatttgattgagagtccaccaacttacaacgtggactat
ggctataaaagctgggaagccttctccaatctctcctactacaccagagctcttccccct
gtggctgatgactgtccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgagggccagctttcaccaaaggactgggccatggggtggacttaagccatatttat
ggggaaactttggatagacaacataaactgcgccttttcaaggatggaaaaatgaaatat
caggtaattgatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatc
tacccaccccatgttcctgaacacctacggtttgctgtgggccaggaagtcttcgggctg
gtgcctggtctgatgatgtacgccacaatttggctacgggaacacaacagagtgtgcgat
gtgcttaaacaggagcatccagagtgggatgatgagcggctattccagacgagcaggctc
atactgataggagaaaccattaagattgtgattgaagactacgtacagcacttgagcggc
tattacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttatctacaacaactctatattg
ctggaacatgggcttacccagtttgtggagtcattcagcaggcagattgccggcagggtt
gctggtggtaggaatgttccagctgcagtacaacaagtagcaaaggcctcaatcgaccag
agcagacagatgaaataccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatgcctcgttcgaagaacttacaggagagaaggaaatggctgcggggttagaggccctt
tatggtgatattgatgccatggaactgtatcctgccctcctgctagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaaatgggagcgccattctccttgaaaggactt
atgggtaatcccatctgttcccctgactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagacccacagctcaccaaaacagtcaccattaat
gcaagctcttcacactccggactagatgatatcaatcccacagtcctactaaaagaacgg
tccactgaactgtaa

DBGET integrated database retrieval system