KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380075Help
Entry
101380075         CDS       T05148                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101380075 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101380075 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101380075 (SDHB)
   05012 Parkinson's disease
    101380075 (SDHB)
   05016 Huntington's disease
    101380075 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101380075 (SDHB)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101380075 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGLSLKRRFPLATVGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LTKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggactctccttgaagcgccggttcccgcttgcaaccgttggcgga
gcttgcctgcaggcctgccggggggcacagacagctgccgcaacagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcacatgcaaact
tatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgccatgaacatcaacggaggcaacactctggcctgcacccgaaggatcgacaccaac
ctcaccaaagtctcaaaaatctaccctcttccgcatatgtatgtgataaaggatcttgtt
cccgacttgagcaacttctacgctcagtacaaatccattgaaccttatttgaagaagaag
gatgaatcccaggagggcaagcagcagtatctgcagtccatagaagatcgtgagaaactg
gacgggctgtacgagtgcatcctctgtgcgtgctgcagcaccagctgccctagctactgg
tggaacggagacaagtacctggggcctgcggttcttatgcaggcctaccgctggatgatc
gactcgagagacgacttcacagaggagcgcctggccaagctgcaggaccccttctccctc
taccgctgccacaccatcatgaactgcaccaggacctgccccaaggggctgaatccaggc
aaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcatcagtg
taa

DBGET integrated database retrieval system