KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381467Help
Entry
101381467         CDS       T05148                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00250  Alanine, aspartate and glutamate metabolism
oro00280  Valine, leucine and isoleucine degradation
oro00410  beta-Alanine metabolism
oro00640  Propanoate metabolism
oro00650  Butanoate metabolism
oro01100  Metabolic pathways
oro04727  GABAergic synapse
Module
oro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:oro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101381467 (ABAT)
   00650 Butanoate metabolism
    101381467 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101381467 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    101381467 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101381467 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    101381467 (ABAT)
Enzymes [BR:oro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101381467 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101381467 (ABAT)
Amino acid related enzymes [BR:oro01007]
 Aminotransferase (transaminase)
  Class III
   101381467 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 101381467
NCBI-ProteinID: XP_004401319
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MAFMLLSRRLACTFQHNYSLLAPSSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMSCGSCSNENAFKTIFMWYR
NKERGQTGFSKEELETCMINQAPGCPEYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLADPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRARGRGTFCSFDTPDETVRNKLILMARNKGVVLGGCGDRSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatgttgcttagccggcggctggcctgcaccttccagcacaactacagcctg
ctcgcgcccagctccagacacatcagtcaagccgcagccaaagtcgacgtcgaatttgat
tatgatgggcccctgatgaagactgaagtcccagggcctagatctcgggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcactttttctgcaattatgaagagagc
cgaggcaattacctggtcgatgtggatggcaaccggatgttggacctatactcccagatt
tcctccgttcccataggctacagccaccctgctctcctgaagctgatccaacagcctcaa
aatgcgagcatgttcatcaacagacctgccctcggaatccttcctccggagaacttcgtg
gagaagctcagggagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atgtcctgtggctcctgctcgaatgaaaatgcctttaagacaatcttcatgtggtaccgg
aacaaggaaaggggtcaaacgggtttctccaaagaggagctggagacgtgcatgatcaac
caggcccccggctgccccgagtacagcatcctctccttcatgggcgcgttccacgggagg
accatgggatgcttagcgaccacgcactccaaagctatccacaagatcgacatcccttcc
ttcgactggcccattgcaccgttcccacggctaaaatacccgctggaagagtttgtgaaa
gagaaccagcaggaggaagcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacagtggccgggatcatcgtggagcccatccagtctgagggtgga
gacaaccatgcgtccgacgacttcttccggaagctgagagacatctccaggaagcatggc
tgtgccttcttggtggatgaggtccagacaggagggggctgcaccggcaagttctgggcc
catgagcactggggcttggccgaccccgcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttcaggcccaatgctccataccggatctttaac
acctggctgggggacccgtccaagaacctgctgctggccgaggtcatcaacatcatcaag
cgggaggacctgctgaacaacgcagcacacgccgggaaggccctgctgacggggctgctg
gacctccaggcccggtacccccagttcatcagcagagcgagaggacgaggcaccttttgc
tccttcgacactcctgatgaaaccgtacggaataaactcattttaatggccagaaacaaa
ggcgtggtattgggaggctgcggggacagatccattcggttccgccccactctggtcttc
agggatcaccacgcgcacctgttcctcaatattttcagcgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system