KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385453Help
Entry
101385453         CDS       T05148                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:oro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101385453 (GPD2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101385453 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored GIDA EF-hand_8 EF-hand_5 Pyr_redox_2 EF-hand_9 NAD_binding_8 HI0933_like EF-hand_10 Pyr_redox Thi4 Pyr_redox_3 RNA_pol_Rpb4 FAD_binding_3 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 101385453
NCBI-ProteinID: XP_004394866
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MAFQKAVKGTLLVGGGALASVLGLSQFAHYRRKQVNLAYVEAAECVSEPVNKEPPSREAQ
LLALQNVSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPHTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKAHNLKAGPSRTVGLFLQGGRDWSPTLY
IRLVQDYGLESEVAQHLATTYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtaaaagggactcttcttgttggaggtggcgcccttgcaagt
gtcctaggcctctctcaatttgctcattacagaaggaagcaagtgaacctggcctatgtc
gaagcagctgagtgcgtctcagaacctgttaacaaggagcctccttccagagaagctcag
ctgctggctttgcagaacgtgtctgaattcgatatcctggtcattggaggaggggcaaca
gggtgcggctgtgcactggatgccgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcatgagcgtgccaacctactagaaattgctccccatttatcagctccgttgcccata
atgcttccaatttacaagtggtggcagctaccttactactgggtaggaatcaagctatat
gatctggttgcaggaagtaattgcctgaaaagcagttatgtcctgagcaaatcaagagcc
ctagaacatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacacaacgacgcacggatgaacctcgccattgccctcactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagtttgctcaagaagacagacccccacacg
gggaaagagcgagtgagcggcgcgcggtgtaaggatgtgctcacagggcaggagtttgat
gtgagagccaagtgtgttatcaatgctacgggacctttcacagacaccgtgcgcaaaatg
gatgataagaacgccacggccatctgccagccgagcgccggcgtccacatcgtgatgcct
ggttattacagccccgagagcatgggacttcttgacccagcaaccagtgatgggcgagtt
atattcttcttaccctggcagaagatgactatagctggcactaccgacactccaacagat
gtcacacaccatcccattccttcggaagaagatatcaatttcattttgaatgaagtgcgt
aactacctgagttgcgatgttgaagtgagaagaggggacgtcctggcagcatggagtggt
atccgtccccttgttactgatcccaagtctgcagatactcagtccatctcccgaaatcat
gttgtggatatcagtgagagtggcctcatcactatagcaggtggaaagtggacaacgtat
cgatctatggcagaagataccataaatgctgctatcaaggctcataatttgaaagcagga
ccaagcagaacagttgggcttttccttcaagggggcagagattggagccccacactctac
attaggcttgtccaggattatgggcttgaaagtgaggtggcacagcatcttgccaccacc
tatggtgacaaggcttttgaggtggccaaaatggcaagtgtaactggaaaaaggtggccc
atcgttggtgtgcgtcttgtgtcagaatttccatacattgaagccgaggtgaaatatggg
attaaggagtatgcctgcacagcagtggatatgatttcacggcggactcgcctggccttc
ctaaatgtccaggcagcagaggaagccctacccagaattgttgaactgatgggcagagaa
ctgaattgggatgattataaaaaagaggaggaacttgaaacagccaggaagtttctgtat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagcctc
ctaccttccgacatcgacaggtacaagaagagatttcataagtttgatgcagaccaaaag
ggctttattaccattgttgatgttcagcgtgtattagagagtatcaacgtccaaatggat
gagaatacactacatgaaattctgaatgaagtagatttgaacaaaaatggacaggttgaa
ctcaatgagtttttgcagctgatgagtgctattcagaaaggaagggtgtctggaagccgg
ctagcgatactgatgaaaactgctgaagagaacctcgacagaagagtccccattccagtg
gaccgaagttgtggaggattgtga

DBGET integrated database retrieval system