KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131463Help
Entry
3131463           CDS       T01015                                 

Gene name
rbcL, OrsajCp033
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3131463 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3131463 (rbcL)
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3131463 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 3131463
NCBI-ProteinID: NP_039391
UniProt: P0C512 A0A0K0LQW8
LinkDB All DBs
Structure
PDB: 

Jmol
Position
CP
AA seq 477 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRSACKWSPELAAACEIWKAIKFEFEPVDKLDS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaggattat
aaattgacttactacaccccggagtacgaaaccaaggacactgatatcttggcagcattc
cgagtaactcctcagccgggggttccgcccgaagaagcaggggctgcagtagctgccgaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggccgatgctatcacatcgagcccgttgttggggaggataatcaatatatcgcttat
gtagcttatccattagacctatttgaagagggttctgttactaacatgtttacttccatt
gtgggtaacgtatttggtttcaaagccctacgcgctctacgtctggaggatctgcgaatt
ccccctacttattcaaaaactttccaaggtccgcctcatggtatccaagttgaaagggat
aagttgaacaaatacggtcgtcctttattgggatgtactattaaaccaaaattgggatta
tctgcaaaaaattatggtagagcatgttatgagtgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgttggagggaccgttttgtcttt
tgtgccgaagctatttataaatcacaggccgaaaccggtgaaattaaggggcattacttg
aatgcgactgcaggtacatgcgaagaaatgattaaaagagctgtatttgcgagggaatta
ggggttcctattgtaatgcatgactacttaaccggggggttcaccgcaaatactagtttg
gctcattattgccgcgacaacggcctacttcttcacattcaccgagcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tctgggggagatcatatccacgctggtacagtagtaggtaagttagaaggggaacgcgaa
atgactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgtgctcgc
ggtatctttttcactcaggactgggtatccatgccaggtgttataccggtggcttcaggg
ggtattcatgtttggcatatgccagctctgaccgaaatctttggagatgattctgtattg
caatttggtggaggaactttaggacatccttggggtaatgcacctggtgcagcagctaat
cgggtggctttagaagcctgtgtacaagctcgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatccgatcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
atatggaaagcgatcaaattcgagttcgagccggtagataaactagatagctag

DBGET integrated database retrieval system