KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339420Help
Entry
4339420           CDS       T01015                                 

Gene name
HXK2, HXK3
Definition
(RefSeq) hexokinase-2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339420 (HXK2)
   00051 Fructose and mannose metabolism
    4339420 (HXK2)
   00052 Galactose metabolism
    4339420 (HXK2)
   00500 Starch and sucrose metabolism
    4339420 (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    4339420 (HXK2)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4339420 (HXK2)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4339420 (HXK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 494 aa AA seqDB search
MRKAAAAAVAAAAAVGVALLVRRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMA
VEMHAGLASEGGSKLKMIISYVDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIK
QEHDEISIPPHLMTGGSNELFDFIASSLAKFVASEGEDFHLAEGRQRELGFTFSFPVKQT
SIASGTLINWTKGFSIDETVGEDVVTELTKALERQGLDMKVTALINDTIGTLAGGRYDDN
DVIAAVILGTGTNAAYVERANAIPKWHDLLPKSGDMVINMEWGNFRSSHLPLTEFDQALD
AESLNPGEQVYEKLISGMYLGEIVRRVLLKMAEEASLFGDEVPPKLKIPFIIRTPYMSMM
HCDRSPDLRTVGAKLKDILGVQNTSLKTRRLVVDVCDIVAKRAAHLAAAGIHGILKKLGR
DVPNTDKQRTVIAVDGGLYEHYTIFAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAAL
LAAAHSQYREAEEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcggcggcggcggcggtcgcggcagcggcggcggtcggcgtggcgctgctg
gtgcgccggcagctgcgggaggcgaagcggtggggccgggccgacgcggtgctgcgggag
ctggaggagcggtgcgcggcgccgccggggcggctgcggcaggtggcggacgcgatggcc
gtcgagatgcacgccgggctcgcctccgagggcgggagcaaactcaagatgatcatcagc
tacgtcgacgccctcccttccggggaagagaagggggtgttttatgcgcttgaccttgga
ggtacaaatttccgtgttttacgggttcaattaggtggcaaggaagggagagttatcaag
caagaacatgacgagatttcaattcctccgcatctgatgactggtggttcaaatgaacta
tttgattttattgcttcttctttagcaaaatttgttgcttcagagggtgaagactttcat
cttgctgaggggaggcagagagaacttggctttacgttctctttcccagtaaagcaaact
tcaattgcatctggcactcttattaattggactaagggtttttcgattgatgaaacggtt
ggtgaagatgttgtgactgaattaaccaaggctcttgaacgccaggggcttgatatgaaa
gtcacagcattgataaatgatactatagggacattggctggtgggagatatgatgataat
gatgtcattgctgctgttatactgggaacaggtactaatgcagcatacgtggaacgtgcc
aatgcaattcctaaatggcatgacctcctgccgaagtcaggagatatggtaataaatatg
gaatgggggaacttcaggtcatcccatcttcctttgactgaatttgatcaagcattagat
gctgaaagtttgaatcctggtgaacaggtttacgaaaagttgatctctggcatgtatttg
ggagaaattgttcgtagagtcctattaaagatggctgaagaagcttctctttttggtgat
gaagtaccaccaaaactcaagattccatttattatcaggactccatacatgtcaatgatg
cactgcgacagatcacctgatctcagaacagttggagcgaaactgaaagatatcctgggg
gtccaaaacacctcccttaaaacaagaaggcttgtggtggatgtctgcgacatcgttgcg
aaacgcgccgctcaccttgctgctgcagggatacacgggatcctgaagaagcttgggcgc
gacgtccccaacaccgacaagcagaggacggtgatcgccgtcgacggtgggctctacgag
cactacaccatcttcgccgagtgcgtggagagcaccctgagggacatgcttggggaggat
gtgtcctccaccattgtcatcaagctcgccaaggacgggtcaggcattggcgctgctctc
cttgctgcggctcattctcaataccgtgaggctgaggagctctag

DBGET integrated database retrieval system