KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342564Help
Entry
4342564           CDS       T01015                                 

Definition
Os07g0181000
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:osa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:osa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:osa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:osa00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:osa00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 561 aa AA seqDB search
TPRLNTKPRKNLRLRHRHRRRRRHGRHRRRGPHPPPPRGPEEALRGAPTPARHPTPTGSS
SHIDVDVATEADLRENGFRSTRRTKLVCTVGPATCGADELEALAVGGMNVARVNMCHGDR
EWHRGVIRAVRRLNEEKGFAVAVMMDTEGSEIHMGDLGGAAAAKAEDGEIWTFSVRSFEA
PPPERTIHVNYEGFAEDVRVGDELLVDGGMARFEVVEKLGPDVKCRCTDPGLLLPRANLT
FWRDGSIVRERNAMLPTISSKDWLDIDFGISEGVDFIAVSFVKSAEVINHLKSYIAARSR
GSDIAVIAKIESIDSLKNLEEIIRASDGAMVARGDMGAQIPLEQVPSVQQKIVKLCRQLN
KPVIVASQLLESMIEYPTPTRAEVADVSEAVRQRADALMLSGESAMGRYPEKALSVLRSV
SLRIEKWWREEKRHEELELKDVSSSFSDKISEEICISAAKMANKLEVDAVFVYTNTGHMA
SLLSRCRPDCPIFAFTTSTSVRRRLNLQWGLIPFRLSFSDDMESNLNRTFSLLKARGMIQ
SGDLVIALSDMLQSIQVMNVP
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
acgcctcgtctgaacacaaaaccccgtaaaaatctccgcctccgccaccgccaccgccgc
cgacgccgccatggccgccaccgccgccgcggcccacaccctcctccacctcgcggcccc
gaggaagccctccgcggggcccccactcccgcccgccacccaaccccaacgggatcctcg
tcgcatatcgatgttgacgtggcgacggaggccgacctgagggagaacgggttccggagc
acgcggcgcaccaagctcgtctgcaccgtggggcccgccacctgcggcgccgacgagctg
gaggcgctcgccgtcggcgggatgaacgtcgcgcgcgtcaacatgtgccacggggaccgg
gagtggcaccggggcgtcatccgcgcggtgcggaggctcaacgaggagaaggggttcgcc
gtcgccgtcatgatggacaccgaggggagcgagatccacatgggggacctcggcggcgcc
gccgccgccaaggcggaggatggagaaatatggacatttagcgtaagatcctttgaggca
cctcccccagaacgaactattcatgtgaactacgaaggcttcgctgaagatgtgagagtt
ggtgatgagcttcttgttgatggtggcatggctcggtttgaggtggttgagaaattagga
ccagatgtcaagtgccgttgcacagatcctggtttgttgctgccacgtgccaatcttaca
ttttggcgggatggtagtattgtccgtgagaggaacgctatgctacctaccatttcatca
aaggattggcttgacatagactttggaatttctgaaggcgtagattttattgcagtttcg
tttgtcaaatctgcagaagtaattaaccatctgaaaagctatatagctgcaaggagccgt
ggcagcgatatagcagtcattgccaagatcgagagcattgactctttgaagaacttggag
gagataatccgtgcttcagatggtgccatggtagcccgaggggatatgggtgcacaaatt
cccttggagcaagtcccctcagtacaacaaaagatagttaaactgtgcaggcagctcaac
aagccagtcattgttgcgtcgcagcttcttgaatcgatgattgagtatcctacgcccacc
agggccgaggttgctgatgtttctgaagcagttcgtcagcgtgcagatgcgcttatgctt
tcaggtgagtcagcaatggggagatatccagagaaagctcttagtgtcctccggagtgtt
agcctaaggattgagaagtggtggagagaggagaagcgccatgaggaactggaacttaaa
gatgtttcatcttccttctctgacaaaatatcagaagaaatctgcatttcggccgctaaa
atggccaacaaattggaggtagatgccgttttcgtctacacaaacactggccacatggcc
tcactgctctcgcggtgccgtcctgactgcccgatcttcgccttcacgacctcgacatct
gtgaggagacgattgaacctccaatggggcctcatccccttccgcctcagcttctcggac
gacatggagagcaacctgaaccgtaccttctcgctgctcaaggccaggggcatgatccag
tccggcgaccttgtcatcgcgctctccgacatgctgcagtccatccaggtcatgaacgta
ccttga

DBGET integrated database retrieval system