KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342564Help
Entry
4342564           CDS       T01015                                 

Gene name
OJ1014_E09.29-1, OJ1014_E09.29-2
Definition
(RefSeq) pyruvate kinase isozyme A, chloroplastic
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4342564 (OJ1014_E09.29-1)
   01230 Biosynthesis of amino acids
    4342564 (OJ1014_E09.29-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4342564 (OJ1014_E09.29-1)
   00620 Pyruvate metabolism
    4342564 (OJ1014_E09.29-1)
  Nucleotide metabolism
   00230 Purine metabolism
    4342564 (OJ1014_E09.29-1)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4342564 (OJ1014_E09.29-1)
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4342564 (OJ1014_E09.29-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 578 aa AA seqDB search
MAATAAAAHTLLHLAAPRKPSAGPPLPPATLRLPSRRLARLTASCSSGSGNNSAADFPNP
NGILVAPPSAAAVAAASSHIDVDVATEADLRENGFRSTRRTKLVCTVGPATCGADELEAL
AVGGMNVARVNMCHGDREWHRGVIRAVRRLNEEKGFAVAVMMDTEGSEIHMGDLGGAAAA
KAEDGEIWTFSVRSFEAPPPERTIHVNYEGFAEDVRVGDELLVDGGMARFEVVEKLGPDV
KCRCTDPGLLLPRANLTFWRDGSIVRERNAMLPTISSKDWLDIDFGISEGVDFIAVSFVK
SAEVINHLKSYIAARSRGSDIAVIAKIESIDSLKNLEEIIRASDGAMVARGDMGAQIPLE
QVPSVQQKIVKLCRQLNKPVIVASQLLESMIEYPTPTRAEVADVSEAVRQRADALMLSGE
SAMGRYPEKALSVLRSVSLRIEKWWREEKRHEELELKDVSSSFSDKISEEICISAAKMAN
KLEVDAVFVYTNTGHMASLLSRCRPDCPIFAFTTSTSVRRRLNLQWGLIPFRLSFSDDME
SNLNRTFSLLKARGMIQSGDLVIALSDMLQSIQVMNVP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccgccgccgcggcccacaccctcctccacctcgcggccccgaggaagccc
tccgcggggcccccactcccgcccgccaccctccgcctccccagccgccgcctcgcccgt
ctcacggccagctgcagcagcggctccgggaacaacagcgccgccgacttccccaacccc
aacgggatcctcgtcgcgcccccgtccgccgcggcggtggcggcggcgtcgtcgcatatc
gatgttgacgtggcgacggaggccgacctgagggagaacgggttccggagcacgcggcgc
accaagctcgtctgcaccgtggggcccgccacctgcggcgccgacgagctggaggcgctc
gccgtcggcgggatgaacgtcgcgcgcgtcaacatgtgccacggggaccgggagtggcac
cggggcgtcatccgcgcggtgcggaggctcaacgaggagaaggggttcgccgtcgccgtc
atgatggacaccgaggggagcgagatccacatgggggacctcggcggcgccgccgccgcc
aaggcggaggatggagaaatatggacatttagcgtaagatcctttgaggcacctccccca
gaacgaactattcatgtgaactacgaaggcttcgctgaagatgtgagagttggtgatgag
cttcttgttgatggtggcatggctcggtttgaggtggttgagaaattaggaccagatgtc
aagtgccgttgcacagatcctggtttgttgctgccacgtgccaatcttacattttggcgg
gatggtagtattgtccgtgagaggaacgctatgctacctaccatttcatcaaaggattgg
cttgacatagactttggaatttctgaaggcgtagattttattgcagtttcgtttgtcaaa
tctgcagaagtaattaaccatctgaaaagctatatagctgcaaggagccgtggcagcgat
atagcagtcattgccaagatcgagagcattgactctttgaagaacttggaggagataatc
cgtgcttcagatggtgccatggtagcccgaggggatatgggtgcacaaattcccttggag
caagtcccctcagtacaacaaaagatagttaaactgtgcaggcagctcaacaagccagtc
attgttgcgtcgcagcttcttgaatcgatgattgagtatcctacgcccaccagggccgag
gttgctgatgtttctgaagcagttcgtcagcgtgcagatgcgcttatgctttcaggtgag
tcagcaatggggagatatccagagaaagctcttagtgtcctccggagtgttagcctaagg
attgagaagtggtggagagaggagaagcgccatgaggaactggaacttaaagatgtttca
tcttccttctctgacaaaatatcagaagaaatctgcatttcggccgctaaaatggccaac
aaattggaggtagatgccgttttcgtctacacaaacactggccacatggcctcactgctc
tcgcggtgccgtcctgactgcccgatcttcgccttcacgacctcgacatctgtgaggaga
cgattgaacctccaatggggcctcatccccttccgcctcagcttctcggacgacatggag
agcaacctgaaccgtaccttctcgctgctcaaggccaggggcatgatccagtccggcgac
cttgtcatcgcgctctccgacatgctgcagtccatccaggtcatgaacgtaccttga

DBGET integrated database retrieval system