KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342654Help
Entry
4342654           CDS       T01015                                 

Definition
(RefSeq) hexokinase-4, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4342654
   00051 Fructose and mannose metabolism
    4342654
   00052 Galactose metabolism
    4342654
   00500 Starch and sucrose metabolism
    4342654
   00520 Amino sugar and nucleotide sugar metabolism
    4342654
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4342654
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4342654
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4342654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4342654
NCBI-ProteinID: XP_015645316
UniProt: Q6Z398
LinkDB All DBs
Position
7
AA seq 509 aa AA seqDB search
MSAAAAIASPIPAAIAVVQQQRRGRSRGGGSGAAAVRCSAVAPTSAIAPILADLRLRCAA
PLPVLRRVADAMASGMRAGLADDGAGELKMIPSHVYSLPTGNETGLFYALDLGGTNFRVL
RVQLGGKDKRIIDTEFEQVSIPREIMHGITEDLFDFIASGLSRFVATEGDKFHLPQGRKR
ELGFTFSFPVNQTSIDSGILIKWTKGFAVSGTAGKDVVACLNAAMERQGLDMRVSALVND
TVGTLAGARYWDDDVMVAVILGTGTNACYIQRTEAIPKLQHLKLETGNTIINTEWGAFSD
GLPLTEFDREMDDESINPGEQIFEKTISGMYLGEIVRRVLVKMAEVSDLFGHSFPKKLAE
PFVLRTPHLCAMQQDTSDNLGEVESILSDVIGVSQASLLARRVTVEVSDCIIRRGGRLAG
AGIVGILEKMENDSRGHIFGRRTVVAMDGGLYEKYPQYRRYMKEAVAELLGPERSNRIAI
EHTKDGSGIGAALLAAANSKYAAAQISTR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgccgccatcgcgtcgccgatcccggcggcgatcgccgtcgtgcagcag
cagaggcgggggaggagccgcggcggcggctccggcgctgccgccgtccgctgctccgcg
gtggccccgacgtccgcgatcgcgcccatccttgccgacctgaggctgcggtgcgccgcc
ccgctccccgtgctgcggcgcgtggcggacgccatggcctccgggatgcgcgccgggctg
gccgacgacggcgccggcgagctcaagatgatccccagccacgtctactcactccccact
gggaatgaaacaggactgttttatgctctggaccttggaggcaccaactttagagtgctg
agggtacaattgggaggaaaagataagcgcattatagataccgagtttgagcaagtctcg
atcccaagagaaatcatgcatggtataaccgaggatttgtttgatttcatcgcgagtggc
ctgtcgagatttgtagcaacggagggtgataagtttcatttgccacaagggagaaagaga
gagttaggcttcacattctcctttccggtgaatcagacttctattgattctggcattctg
atcaagtggacaaaaggttttgctgtctctggaactgctgggaaagatgttgttgcttgt
ctgaatgctgcaatggagaggcaaggccttgatatgcgtgtctctgccttggtaaatgat
actgtgggaaccttagctggagcacgttattgggacgatgacgtaatggtcgcggtgatt
ttgggcactggcaccaatgcatgctacattcaacgaactgaagctattccaaaattgcaa
caccttaagcttgaaacaggaaacacgattattaacactgagtggggagctttctcagat
ggacttccattgactgaatttgacagagaaatggatgatgagagcataaatcctggtgaa
cagatattcgagaagacgatttccgggatgtatctaggtgaaattgtccgtagggtgctg
gtcaagatggctgaagtatctgatctctttggtcattccttccccaagaaacttgctgaa
ccatttgttctaaggacaccacatctatgcgctatgcaacaagacacctctgacaatctt
ggagaagttgagtccatcttgagtgatgtcatcggcgtgtcccaagcttctctgctggca
cggagagtcactgtagaagtctccgactgcatcatcaggagaggaggccggttggccggg
gcaggaatcgtagggatccttgagaagatggagaatgactccagagggcacattttcgga
cgaagaacagtggtcgcgatggacggtggtctatatgagaagtaccctcagtacaggagg
tacatgaaggaggctgtggctgagctactgggacccgagcgatcgaatcgtatcgccatc
gagcacacgaaagacggatcagggatcggcgctgcgctgttggcagctgcaaactcaaag
tatgctgctgctcaaatctctacaaggtga

DBGET integrated database retrieval system