KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345787Help
Entry
4345787           CDS       T01015                                 

Definition
(RefSeq) glutamate decarboxylase isoform X1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    4345787
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4345787
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4345787
   00430 Taurine and hypotaurine metabolism
    4345787
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4345787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 501 aa AA seqDB search
MVVSVAATDSDTAQPVQYSTFFASRYVRDPLPRFRMPEQSIPREAAYQIINDELMLDGNP
RLNLASFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDE
TAIGVGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEV
ELKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNNLLTEKNKETG
WDVPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKEDL
PEELIFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCMENTAILRE
GIEATGRFEILSKEAGVPLVAFSLKDSGRYTVFDISEHLRRFGWIVPAYTMPANAEHVAV
LRVVIREDFSRSLAERLVSDIVKILHELDAHSAQVLKISSAIAKQQSGDDGVVTKKSVLE
TEREIFAYWRDQVKKKQTGIC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgagcgtggccgcgaccgactcggacacggcccagccggtgcagtactccacc
ttcttcgcctcccgctacgtccgcgacccgctcccgcggttcaggatgccggagcagtcg
atcccgagggaggcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccg
cggctgaacctggcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatc
atggactccgttaacaagaactacgtcgacatggacgagtaccctgtcaccacggagctc
cagaaccgttgtgtgaatatgatagctcacctgttcaatgcaccaatcaaggaggatgaa
acagctattggagttgggacggtgggatcctcagaagcaattatgcttgcaggactggca
ttcaagaggaagtggcaaaacaaacggaaggaacaggggaagccatgtgacaaacccaac
attgttactggtgctaatgttcaggtttgctgggagaaatttgccagatattttgaagta
gaactgaaggaggttaagctcagtgaaggatactatgtcatggatcctgtaaaggctgtt
gaaatggtggatgagaacactatatgcgttgcggccatcttgggctctactctcactgga
gagtttgaggatgttaagttattgaataatctcctaacagaaaagaataaggaaactggg
tgggatgtgccaattcatgttgatgcagcaagtggaggatttatagcaccttttctatac
cctgagcttgaatgggacttcaggctaccactggtgaagagcatcaatgtcagtgggcac
aagtatggccttgtgtatccaggtgttggttgggtcatttggcgaagcaaagaggatttg
cctgaagaactcattttccatataaactatctggggacagaccagccgacgttcactctg
aacttctccaaaggttccagccagataatcgcacagtactatcaactaatacgcctggga
ttcgagggatacaagaacatcatgcagaattgcatggagaacacagcaatactaagggaa
ggcatagaggcgactggtcgattcgaaatcctctccaaggaggccggtgtgcccttggtg
gcgttctcgctcaaggacagcggcaggtacaccgtgttcgacatctccgagcacctgagg
aggttcggctggatcgtgccggcgtacaccatgccggccaacgccgagcacgtcgccgtc
ctccgcgtcgtcatcagggaggacttcagccggagcctcgccgagcggctcgtctcggac
atcgtcaagatcctgcacgagctggacgcccattcggcccaggtgctgaagatctccagc
gccatcgcgaagcagcaatcgggcgacgatggcgtggtcaccaagaagagcgtcctggag
accgagagggagatcttcgcgtactggagggaccaggtgaagaagaagcagaccggaatc
tgctag

DBGET integrated database retrieval system