KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347319Help
Entry
4347319           CDS       T01015                                 

Definition
(RefSeq) glutathione transferase GST 23
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    4347319
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4347319
Transporters [BR:osa02000]
 Other Transporters
  Pores ion channels [TC:1]
   4347319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 4347319
NCBI-ProteinID: XP_015611712
UniProt: Q93WY5
LinkDB All DBs
Position
9
AA seq 223 aa AA seqDB search
MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV
HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG
EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGVEVVTD
EALPLMKAWFDRVLAVDAVKAVLPPRDKLVALNKARREQILSA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacaagggagtgaaggtgttcggcatgtgggcgagccccatggcgatccgt
gtggagtgggcgctccggctcaagggcgtcgactacgagtacgtcgacgaggacctcgcc
aacaagagcgaggcgctgctccggcacaacccggtgaccaagaaggtgcccgtgctggtc
cacgacggcaagcctctcgccgagtccaccgtcatcgtcgagtacatcgacgaggcctgg
aagcacggctaccccatcatgccctccgaccccttcgaccgtgctcaggcgaggttctgg
gccaggttcgctgaagagaagtgcaacgctgctctgtacccgatcttcatgacgaccgga
gaggagcagagaaagctggtgcacgaggcccagcagtgcctgaagacgctggagacggcc
ctggaggggaagaagttcttcggcggcgacgccttcggctaccttgacatcgtcaccggg
tggttcgcctactggctgccggtcatcgaggaggcctgcggcgtcgaagtcgtcaccgac
gaggcgctgcccctgatgaaggcctggttcgaccgggtcctcgccgtcgacgccgtgaag
gcggtcctgccgccgagggacaagctcgtcgcgctcaacaaggctcgccgtgagcagatc
ctctcggcgtag

DBGET integrated database retrieval system