KEGG   Oceanicoccus sagamiensis: BST96_06905Help
Entry
BST96_06905       CDS       T04832                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00440  Phosphonate and phosphinate metabolism
osg01100  Metabolic pathways
osg01120  Microbial metabolism in diverse environments
osg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:osg00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BST96_06905
Enzymes [BR:osg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BST96_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA
Motif
Other DBs
NCBI-ProteinID: ARN73867
UniProt: A0A1X9NFZ4
LinkDB All DBs
Position
complement(1532530..1533828)
Genome map
AA seq 432 aa AA seqDB search
MKKVYVGMSADLIHPGHINIINEAQKLGEVTVGVLTDQAIASYKRLPFLSYEQRKGVVEN
IKGVSSVVPQETLDYRPNLQAYKPDIVVHGDDWKSGVQAKTRQQVIDTLAEWGGDLVEVT
YTEGISSTQLHEGLKEVGTTPDIRLKRLRRLIDAKPIVRVLEAHTPLCGLIIEHANADVE
GVKREFDAMWSSSLTDSTAKGKPDIEALDLTSRLQNINDTFEVTTKPLIYDADTGGIPEH
FAFTVKSLERVGVSAVIIEDKVGLKKNSLFGNDVEQQQASIEEFCHKIAVGKNAQITDDF
MVIARIESLILERGMDDAVERAKAYIAAGADGIMIHSREKSPAEILEFCAIYRALETQVP
LVAVPSSYNSITDTELADAGVNVVIYANHMLRAAYPAMNDVAHSILEHGRSLECADKCMP
IKGILDLIPGTR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtttacgtaggaatgagcgccgatttaatccacccaggccatataaatatt
ataaatgaagctcaaaaactaggagaggtgacagtaggggttctgaccgatcaggctatt
gcaagttacaagcgcttgccctttctttcttatgagcagcgaaagggggttgtagaaaat
attaagggtgtaagtagtgttgtccctcaggagacgcttgactaccgccccaaccttcag
gcctacaagcctgacatcgttgtgcatggtgatgactggaagtccggtgtacaagccaaa
acccgtcagcaagtgattgatacgttggctgagtggggcggtgatttggttgaggttacc
tatactgaaggtatctcatctacccagttgcatgaaggtttaaaagaagttggtacgaca
ccggatattcgtctgaagcgcctgcgtcgattaattgatgccaagcctattgtgcgtgtt
ttggaagctcatacacccctttgtggcttgataattgagcacgcgaatgctgatgttgag
ggcgtgaagcgcgagtttgatgcgatgtggtcaagcagcttgacggattcaaccgccaag
ggaaaacctgatatcgaagctctggatttaacctccaggctgcagaatatcaatgatact
tttgaagtaactacaaagcctcttatctatgatgctgataccggtggtattcctgaacac
tttgcttttactgttaaaagcctggagcgcgttggagtttcggcggtcattattgaagat
aaggtgggtctgaagaagaattcgctttttggtaatgacgttgagcagcaacaggctagc
attgaagaattttgtcataaaatagccgtcggtaaaaatgcccagatcacagatgacttt
atggtgatagcccggatagagagcctgattcttgagcggggtatggatgatgcggttgaa
cgggctaaagcatatattgctgcaggcgcggacggcattatgattcatagtcgtgaaaaa
agcccagctgaaattctggagttttgcgctatatatcgcgcacttgaaactcaggtacca
ctagttgccgtgccttccagctacaatagtattacagatactgaacttgctgatgcaggt
gtgaatgtagtgatttacgctaaccacatgttgcgagcggcgtatccagcgatgaatgac
gttgctcactcaatactagagcatggacggtctttggagtgtgccgataagtgtatgcca
atcaagggaattttagatttaataccagggaccagataa

DBGET integrated database retrieval system