KEGG   Ostreococcus tauri: OT_ostta01g04510Help
Entry
OT_ostta01g04510  CDS       T01358                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ota  Ostreococcus tauri
Pathway
ota00240  Pyrimidine metabolism
ota01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OT_ostta01g04510
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     OT_ostta01g04510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK zf-C4pol Ribosomal_L40e
Motif
Other DBs
NCBI-GeneID: 9835003
NCBI-ProteinID: XP_003074504
LinkDB All DBs
Position
1
AA seq 299 aa AA seqDB search
MLTRIDEDGSKSGSLEVIFGPMFSGKSTELQRRLRRHNVANRRVLVVKYAGDNRYDGAVG
STTSAVTHDLATMPALPAKDLKNIDNVSHNYDVIGIDEGQFFDDVAHYCEKWAQAGKTVI
VAALDATFQRKPFNSVLQLVPLAESVTKLTAVCTDCAADAAFTARTTKETAVEVIGGASS
YKAVCRRCYAKYASEMHENGASVNVTSVKAAGTPLTKRVAESMSELTLKTPAPTESSFTF
TTPATPQMARDTTQKMKNVDAMSSKSAKKSRGFGGPGRSPLGDFMNGSGLHRSPLSTLR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttgacacgaatcgacgaggacggatcgaaatcggggtcgctggaggtgatcttcgga
ccgatgttcagtgggaagtccactgagctgcagagacggcttcggaggcataatgtagcg
aataggcgcgtgctcgtggtgaagtacgcgggtgataacagatatgacggcgcggtgggt
tcgacgacgtcggcggtgacgcacgatctggcgacgatgccggcgctgccagcgaaggat
ttgaaaaacatcgataacgtgtcgcacaactacgacgtgatcgggatcgatgagggacag
ttcttcgatgacgtggcgcactactgcgaaaagtgggcgcaggctgggaagactgtcatc
gtggctgcgctcgatgcgacgtttcaacgcaagcctttcaactcggtgcttcagctcgtg
ccactggcggaaagtgtcactaaattgaccgccgtctgcacagattgcgctgcagatgct
gcgttcaccgcgcgcacaacgaaggagacggcggtggaagtcatcgggggtgcctcatcg
tacaaggctgtttgcaggcgttgttacgcgaagtacgcctcagaaatgcacgagaacggt
gcgagtgtaaatgttacatcggtgaaagccgccgggacgccgctgacgaagcgtgtcgct
gaaagcatgagcgaactcaccctgaagacgccggcgccaacggagagctcgttcacgttc
actactccggcgactccacagatggctcgggacacgacgcagaaaatgaaaaatgtcgac
gcaatgtcttcgaagagtgcgaagaagtcgcgtggcttcggcggcccgggacggtcaccg
ttgggcgacttcatgaacggttcgggtttgcaccgttctccactcagcacgctgcgatag

DBGET integrated database retrieval system