KEGG   Opitutus terrae: Oter_3378Help
Entry
Oter_3378         CDS       T00689                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ote  Opitutus terrae
Pathway
ote00052  Galactose metabolism
ote00511  Other glycan degradation
ote00600  Sphingolipid metabolism
ote01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Oter_3378
  Lipid metabolism
   00600 Sphingolipid metabolism
    Oter_3378
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Oter_3378
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Oter_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ACB76655
UniProt: B1ZU93
LinkDB All DBs
Position
complement(4430178..4432937)
Genome map
AA seq 919 aa AA seqDB search
MTSSLKTGFTFAFVGLLGFFTAQSLPAEQPFAAHGERSSAQLRERLPLNDDWRFQKDDPP
GNTVSLDYDVRPVVTTNQDGRAADAEPTEAEKLAAASRVVLKPWILPTGNAFIKDPAPRY
TRPAGDPGSDVAYVRADFDDQAWRRVNLPHDWAIEGPFLTTGDFGGMGRLPSWGIGWYRK
AFDLPAEDAGKSIVLEVDGAMSYATVWLNGHLVGGWPYGYSSWQVNLTPYLAFGGRNQLA
IRLDNPPASSRWYPGGGIYRNVWLTKTQPVHVGQWGTAVTTRDVTSRSATIELAVTVDND
GREPAPISVSSEIFALDLQGRKTAEVVARTEAIETQVAAGAAATVRSSVALANPKLWGPP
PTQQPHRYVAVTTVTRAGQPVDVYETPFGIRTLRFDPAAGIFVNGERIKLQGVNQHHDLG
ALGAAYNERAAERQLEMLREMGCNAVRMSHNPPAPELLELTDRMGFLVIDESFDVWERKK
TPLDHHLIFPDWHEQDLRALIRRDRNHPSVIVWSVGNEVGEQYTGEAGAAVAKRLVAIVH
EEDPTRPATSAMNYASPDMPLPAALDVISLNYQGEGIRDTPEFEGTERIRKTPQYPAFHA
QFPQKVILTSESASAFSSRGVYLFPVTPKISDVVRDGRGGDSTIHQVSGYELHAVDFGSS
ADKVFGSLDRHPYVAGEFVWTGWDHLGEPTPYYTSRSAYCGIIDLAGFKKDRFYLYQSRW
RPDLPMAHLLPHWTWPERVGQVTPVHVFTSGDEAELFLNGQSLGRKRKGAYEYRLRWDDV
VYAPGTLEVVAYKDGKKWATDRVVTAQPAAALTAEPDRAEIRADGRDLSFVTVRVVDAAG
VLAPRADHRIRFQIAGPGEIVATDNGDPTSFESFQAPERKAFSGQCLVIVRGQRGQAGKI
TITASGEGLEEAVTVITAR
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttccctcaaaaccggattcacattcgctttcgtcgggctgcttggattcttc
acggcgcagtcgctcccggcggagcagccgtttgccgcccatggcgagcggtcgtccgcc
caactgcgtgaacggctgcccctgaacgacgactggcgatttcaaaaagacgatccgccg
ggcaacaccgtcagtctcgactacgatgttcgtcccgtggtgacgacgaaccaggacggc
cgggcggcggatgccgagccgacggaagccgagaagctcgccgccgcctcgcgcgtggtg
ctgaagccgtggatcctgccgaccgggaatgcgttcatcaaggatccggcgcctcgatac
acccggccggcgggcgacccgggcagcgacgtggcgtatgtgcgggcggatttcgacgat
caagcctggcggcgcgtgaacctgccgcatgactgggcgatcgaagggccgtttctcacc
accggcgatttcggcggcatgggcaggctgcccagctggggcatcggctggtatcggaag
gcgttcgatcttcccgcggaggacgccggcaaatcgatcgtcctcgaggtggatggcgcc
atgtcgtacgcgacggtctggttgaatggtcacctcgtgggcggctggccgtatggctac
tcgtcgtggcaggtgaacctgacgccttacctcgcttttggcggcagaaaccaactcgcg
atccggctcgacaatccgcccgcctcgtcgcgctggtatccgggcggcgggatttatcgc
aacgtgtggctgacgaagacgcagccggtgcacgtcggccagtggggcaccgcggtaacg
acgcgtgacgtgacgtcgcgttcggcgacgatcgagctcgcggtcaccgtcgacaacgac
ggccgggagcctgcgccgatcagcgtgagctcggagatcttcgcgctggatttgcagggc
cggaaaacggcggaggtggtcgcgcggacggaggccattgaaacccaagtggcggcgggc
gcggccgcgaccgtgcggagttcggtcgcgctcgcgaatccgaagttgtgggggccgccg
ccgacccagcagccgcatcgctacgtggcggtgacgaccgtgacccgcgccggccagccg
gtggatgtctacgagacgccgttcggcattcggacgctgcggttcgatccggcggcggga
atttttgtcaatggcgagcggatcaagctccaaggcgtgaaccagcaccacgaccttggc
gcgttgggcgcggcctacaacgaacgcgcggcggaacggcagctggagatgctgcgtgag
atgggctgcaacgccgtccggatgagccacaatccaccggcgcccgagttgctggagctg
accgatcggatgggttttctcgtgatcgacgagtcgttcgatgtctgggagcgcaagaag
acgccgctcgatcaccatctgattttcccggactggcacgagcaggatttgcgcgcgctg
atccggcgcgatcgcaatcatccgtcggtgatcgtgtggagcgtcggcaacgaagtcggc
gagcaatacacgggcgaggccggagcggcggtggcgaagcggctcgtcgccatcgtacac
gaggaggatcccacgcggccggcgaccagcgcgatgaactacgccagccccgacatgccc
ctgccggcggcgctggatgtgatcagcttgaactatcagggggagggaattcgcgacacg
ccggagttcgaaggcacggagcgaattcggaagacgccgcagtatccggcgtttcacgcg
cagttcccgcagaaggtgatcctgacgagcgagagcgcgtcggcgttcagcagtcgcggc
gtttaccttttcccggtgacgccgaagatcagcgacgtggtgcgcgacggacgtggcggc
gactccacgattcaccaggtgagcgggtacgagctgcacgcggtggatttcggctcctcg
gcggacaaggtcttcggttcgctggatcgtcatccttacgtggcgggcgagttcgtgtgg
accgggtgggatcatctgggggaacccacgccctattacacctcgcggagcgcgtattgc
gggatcatcgacctggcggggttcaagaaagaccggttctatctgtaccagtcgcgctgg
cggcccgacctgccgatggcgcacctgctgccgcattggacctggccggaacgcgtgggt
caggtgacgccggtgcacgtgttcacctcgggcgacgaggccgagcttttcctgaacggg
caatcgctcggtcggaagcgcaagggcgcgtatgaataccggttgcgctgggacgacgtg
gtctacgcgccgggcacgctcgaagtcgttgcctacaaggacgggaagaagtgggcgacg
gaccgcgtggtgacggcgcagccggcggccgcgttgacggcggagccggaccgcgcggag
atccgggcggatggccgggatctgtcgttcgtcacggtgcgggtggtggacgcggcgggc
gtgttggcgccgcgggcggaccatcggattcggttccagatcgcagggccgggcgagatt
gtcgcgaccgacaacggggatccgacgagcttcgagtcgttccaggcgccggagcgaaaa
gcgttcagcggacagtgcctggtgatcgtccgcgggcagcgcggccaggcggggaagatc
acaattacggcctccggcgaagggctggaggaagcggtcacggtgatcaccgcgaggtga

DBGET integrated database retrieval system