KEGG   Pelagibaca abyssi: Ga0080574_TMP440Help
Entry
Ga0080574_TMP440  CDS       T04681                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
paby  Pelagibaca abyssi
Pathway
paby00250  Alanine, aspartate and glutamate metabolism
paby00410  beta-Alanine metabolism
paby00640  Propanoate metabolism
paby00650  Butanoate metabolism
paby01100  Metabolic pathways
paby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ga0080574_TMP440
   00650 Butanoate metabolism
    Ga0080574_TMP440
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ga0080574_TMP440
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ga0080574_TMP440
Enzymes [BR:paby01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ga0080574_TMP440
Amino acid related enzymes [BR:paby01007]
 Aminotransferase (transaminase)
  Class III
   Ga0080574_TMP440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: APZ50774
UniProt: A0A1P8UMZ7
LinkDB All DBs
Position
pPABY1:complement(146754..148031)
Genome map
AA seq 425 aa AA seqDB search
MLNAEISARRDAAISRGVGMQTQVYVERASGSEVWDVEGKRYIDFAAGIAVVNTGHCHPK
AMEAVRRQSEAFTHTCHQVLPYENYIRLAERLNDKVPGDFEKKTVFVTTGAEAVENAIKV
ARAATGRNAIIAFGGGFHGRTFMGMSLTGKVAPYKKGFGAMMPDVFHVPFPVELHGTSTV
DALAGIEKLFKADLDPDRVAAIILEPVQGEGGFYPAPAELMRALRDLCDTHGILLIADEV
QTGFARTGHLFAMEGYDVAADITTMAKGLAGGLPLAALTGRAEIMDAAAPGGLGGTYGGN
PLGIAAAHAVLDVIEEENLCNRANILGSRLKQRLNEIRSRVPEIVDVRGPGFMVAAEFNT
ADGSAPNPEMTNAIRAEALRRGLVLLTCGVHGNVIRFLAPLTIPEDVFAEALDILEASID
AVKGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgccgaaatctccgcccgccgcgacgccgccatctctcggggtgtcggcatg
cagacgcaggtctatgtcgaacgtgcctccgggtcggaagtctgggacgtcgagggcaag
cgctatatcgactttgccgccgggatcgccgtggtgaacaccggccattgccaccctaag
gcgatggaggcggtgcgccgccaatccgaggccttcacccatacctgccatcaggtcctg
ccttacgagaactacatccggctggccgaacggctgaacgacaaggtgcccggcgatttc
gagaaaaagaccgtctttgtcaccaccggggccgaggcggtagaaaacgccatcaaggtc
gcccgcgccgccaccggtcgcaacgccatcatcgcctttggcggcggcttccatggccgg
accttcatggggatgagcctgacgggcaaggtcgccccctataagaagggcttcggcgcg
atgatgcccgatgtcttccatgtgcccttcccggtcgagctgcatggcacctccacggtc
gatgcgctggcggggatcgaaaagctgttcaaggccgatctcgaccccgaccgcgtggcc
gcgatcatccttgagccggtgcagggcgagggtggcttctatcccgcgcccgccgaattg
atgcgcgccctgcgcgacttgtgcgacacccatggcatcctgttgatcgcggatgaggtg
cagacgggtttcgcgcgcaccggtcacctgttcgcgatggagggctatgacgtcgccgcc
gacatcacgaccatggccaaaggtctggccgggggcctgccgcttgccgcgctcaccggc
cgggccgagatcatggacgccgcggcccccggcgggctggggggcacctatggcggcaac
cccctgggcatcgccgccgcccatgcggtgctggacgtgatcgaggaagaaaacctctgc
aatcgcgccaatatccttggatcgcgtctgaaacagcggctcaacgaaatccggtcgcga
gtgccggaaattgtcgatgtgcgcggccccggtttcatggtcgcggcagagttcaacacc
gccgatggcagcgcgccgaaccccgaaatgaccaatgccattcgcgctgaagcgctcaga
cgcgggctcgttctgctgacctgcggggtccacggcaacgtgatccgtttcctcgcgccg
ctgaccatccccgaggacgtctttgccgaagcgctcgacattctggaggcgtcgatcgac
gctgtgaaaggggcctga

DBGET integrated database retrieval system