KEGG   Candidatus Paracaedibacter acanthamoebae: ID47_06355Help
Entry
ID47_06355        CDS       T03232                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paca  Candidatus Paracaedibacter acanthamoebae
Brite
Enzymes [BR:paca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ID47_06355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1327230..1327823)
Genome map
AA seq 197 aa AA seqDB search
MTHQLPPLPYDMNALEPHITANTLSFHYGKHHQAYVTNLNKLLEGHPLENSSLEEVIMSS
AGKSNMVGIFNNAAQVWNHTFYWNCMKSNGGGEPSANFKEKIEKAFGGWDKFLAEFKDAA
VTQFGSGWAWLVKDGNGDLKLLKTGNADLPMAHGMTALLTCDVWEHAYYLDFQNRRPDYV
DTFLKYLVNWDFVESQL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcaattaccaccgttaccttatgatatgaatgctctcgagccccatattaca
gccaatactctttctttccactatggcaagcatcaccaagcctatgtgacaaatctgaat
aaacttttagaaggtcatcccttggaaaattctagtttagaagaagttattatgagttcg
gctggaaaaagcaatatggttgggatttttaataatgcggctcaagtttggaatcacacc
ttttattggaactgtatgaaatcaaatggtggtggtgaaccatcggctaattttaaagaa
aaaatcgaaaaggcctttggcggctgggataaatttttagcagaatttaaggatgctgct
gttactcaattcggtagtggttgggcctggttggttaaggatgggaatggcgacttaaag
ctgttgaagacagggaatgctgatctgcccatggcgcatggaatgacggcactcttgacg
tgtgatgtgtgggaacatgcctattatcttgatttccagaatcgtcgtccagattatgtg
gatacattcttaaagtacctagttaattgggattttgttgaaagccagctgtag

DBGET integrated database retrieval system