KEGG   Propionibacterium acnes subsp. defendens ATCC 11828: TIIST44_11035Help
Entry
TIIST44_11035     CDS       T01972                                 

Definition
(GenBank) sialidase A precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pad  Propionibacterium acnes subsp. defendens ATCC 11828
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TIIST44_11035
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TIIST44_11035
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TIIST44_11035
Bacterial toxins [BR:pad02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TIIST44_11035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2342319..2344634
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALLPARKGMDVQRIDSEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDADRLLGRIDLNGETRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRAWCQDLGATNVVINPSGVLDVRRFRMWNSALSLQAMAAKAPAATPFVEFAGSELSAR
DARRTGELTHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVDGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFLADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVVDAEGIVTTESGEPTDYT
IDETGNVFVAGTPAGNIHLAAGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDEGQTWNLGKSP
NDERELFGKIVSSRHLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASIDGGET
WGEVTFVEQLTEIFSQPNAISVRDECGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQRDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcaccggaagcgccttg
ctgccggcccgaaagggcatggacgtgcaacgaatcgacagcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgcagaccgcttgcttggccgtatagatctgaacggagaaact
cgcagtctcgacgccgaggatgcgctaggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggcatggtgccaggacctgggagcaaccaatgtcgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaggatgtggaactcagccctatccttgcaagctatggcg
gccaaggcgccggcggcaacaccgttcgtcgagttcgctggttctgagctgtcggcccgc
gacgcacgccgtaccggagaactcactcatggcgcactccgagcaaggacccgccttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcgacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
aggggcgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttccttgccgatcttggcaaggtcgaaagggtgaccgtcgggaaggacctcgaaggagca
cggctattcggggaagcgcagacggcatccatcttcagcagtgcgctgaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ttgggctcgaaaagttaccggatcccatcgctaatcagacttgattccggaagctttatc
gccggggcagaccaacgcgtcagcattgccaacgacagccctaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggctcagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
ggacgcgtgttctgcttgatcgaccagttcccgggtggcgtagggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgaccgcgatgcaaccgcc
tacgtcgtcgatgcagaaggcatcgtgacaaccgagtcgggggaacccacggactacacc
attgacgaaaccggaaacgtcttcgtggccggtacccccgccggcaatatccacttggcc
gccggagtggacccccacgagtctctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacgtggtcacgacctatcaacctgaacccggctctcaaa
cagccttggatgcggttcctcggtacttcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtttactacaaccatgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgagggccagacatggaatctcggtaagtcacca
aacgacgagcgcgaactgttcggaaagatcgtcagttctcgacatctcaacgatgatcgc
ggctcgacccatgagtcagcgttggtagaaacccctgacggtgtcgtgcactcctttatg
cgcaaccaacatccctccggacgggtggcgcatgcagccagcatcgacggtggcgaaaca
tggggcgaggtgacgttcgtcgagcagctgaccgaaatcttctcccagcccaatgccatc
tctgtccgggatgagtgtggaaccgaatcggtggtcttcgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtattgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgacccagcgagacgaacag
actctgctcgtgttgtgggaacgggagtggcaaggcctgttcctgacagaggtcccgttg
tcatggctcaccacttcgcgcagcacgctggagtaa

DBGET integrated database retrieval system