KEGG   Pseudomonas aeruginosa PAO1: PA1655Help
Entry
PA1655            CDS       T00035                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA1655
Enzymes [BR:pae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PA1655
Transporters [BR:pae02000]
 Other Transporters
  Pores ion channels [TC:1]
   PA1655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-GeneID: 882280
NCBI-ProteinID: NP_250346
PathoGenesis: PA1655
UniProt: Q9I370
LinkDB All DBs
Position
1801851..1802453
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYRSGNCYKIKLAMSLLGIDYQWVPVDILKGETQTPEFLAKNPNGKIPVLELED
GSCLWESNAILNFLADGSALLPSEPRLRTQVLQWQFFEQYSHEPYVAVARFIKLYLGLPE
ARRAEFEEKKIGGYKALDVMEKQLSRTPFLVGEQFSIADITLYAYTHVAHEGGFDLTAYP
AIRAWIKRVGEVPGYVGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtctacggtgattaccgttcgggcaactgctacaagatcaagctggccatg
tcgctgctcggcatcgactaccagtgggtaccggtggacattctcaagggcgagacccag
accccggagttcctggcgaagaaccccaacggcaagataccggtgctggagctggaggac
ggcagttgcctgtgggagtccaacgccatcctcaacttcctcgccgacggcagcgccctg
ttgcccagcgaaccgcgcctgcgcacccaggtgctgcaatggcaattcttcgagcaatac
agccatgagccctatgtggccgtggcgcgcttcatcaagctctacctcggcctcccggaa
gcccgccgcgccgagttcgaagagaagaagatcggcggctacaaggccctcgacgtcatg
gagaaacagctgtcgcgcacgccattcctggtcggcgaacagttctccatcgccgatatc
accctctacgcctacacccatgtcgcccatgaaggcggcttcgacctgacggcctacccg
gcgatccgcgcgtggatcaagcgagtgggggaggtgccggggtatgtggggatgctggat
tga

DBGET integrated database retrieval system