KEGG   Pseudomonas aeruginosa PAO1: PA2821Help
Entry
PA2821            CDS       T00035                                 

Definition
(RefSeq) glutathione S-transferase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 879868
NCBI-ProteinID: NP_251511
PathoGenesis: PA2821
UniProt: Q9I022
LinkDB All DBs
Position
3174966..3175628
Genome map
AA seq 220 aa AA seqDB search
MSLTLYGAPLSPFVRKVRLLLAEKGLDYQLEAIAPFGQPAWYREISPLGRIPALRDGDLA
LADSSVICQYLEERYPEPPNLQGDAPASRAAVRWLEKYADYEIAPLATLTIFRNRILKPA
MGQACEENDVRRALEEKLPAHFDYLENHLDGRAFFVGERLTLADLAIASQLVNLRHAGEN
LDEQRWPALAAHFARMLERPAMQALLPGERRTLDKLAAKA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacactctacggagccccgctgtctccgttcgtccgcaaggtccgcctgctc
ctggccgaaaagggcctcgactaccagttggaagcgatcgccccgttcggccagccggcc
tggtatcgcgagatcagtccgctgggccgcatcccggcgttgcgcgacggcgacctggcc
ctcgccgactccagcgtgatctgccagtacctggaagaacgctatcccgaaccgccgaat
ctccagggcgacgcccccgccagccgcgcagcggtgcgctggctggaaaaatacgccgac
tacgagatcgctcccctggccacgctgacgatcttccgcaaccggatactcaagccggcg
atgggccaggcctgcgaggagaacgacgtgcgtcgcgcgctggaggaaaagctgccagcg
cacttcgattacctggaaaaccatctcgacggccgggccttcttcgtcggcgagcgactg
accctcgccgacctggcgatcgccagccagttggtcaacctgcgtcacgccggcgaaaac
ctggacgagcaacgctggccggccctcgccgcgcatttcgcgcggatgctcgaacgcccg
gcgatgcaagcgctgctgccgggggaacgacggaccctcgacaagctcgcagcgaaagcc
tga

DBGET integrated database retrieval system