KEGG   Pseudomonas aeruginosa PAO1: PA4410Help
Entry
PA4410            CDS       T00035                                 

Gene name
ddlB
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00473  D-Alanine metabolism
pae00550  Peptidoglycan biosynthesis
pae01100  Metabolic pathways
pae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA4410 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA4410 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PA4410 (ddlB)
Enzymes [BR:pae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA4410 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pae01011]
 Precursor biosynthesis
  Amino acid ligase
   PA4410 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-GeneID: 881282
NCBI-ProteinID: NP_253100
PathoGenesis: PA4410
UniProt: Q9LCT6
LinkDB All DBs
Position
complement(4942677..4943636)
Genome map
AA seq 319 aa AA seqDB search
MNLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDAFGIDVGE
DLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGVLASALAMDKLRTKRVW
LSLGLPTPDYAVLASEDDCREAAQRLGFPLIVKPAHEGSSIGMAKVGGLDELIAAWREAA
RYDSQVLVEQWISGPEFTVATLRGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDE
AKERELKELTARACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAG
LDFQQLVLAILADSREARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttgcctcgatagcctgctgaacggcacccaggatcccaaggcgttcggccgt
gtcgccgtgctgttcggcggcaagagcgccgagcgcgaggtgtcgctgaagtccggcgcg
atggtcctgcaatccctgctggccgccggggtcgatgccttcggcatcgatgtcggcgaa
gacctgctgcaacgcctggtcgaggagaagatcgaccgtgccttcatcattctccacggt
cgtggcggcgaggatggcagcatgcagggcctgctcgagtgcgcgggcattccctacacc
ggcagcggcgtgctggcctcggcgctggcgatggacaagctgcggaccaagcgggtctgg
ctcagcctcggcctgccgaccccggactacgcggtgctggccagcgaggatgactgccgc
gaagcggcgcagcgactgggtttcccgctgatcgtcaagccggctcacgaaggctcgagc
atcggcatggccaaggtcggcgggctcgacgaattgatcgcggcgtggcgcgaagcggcc
cgctacgactcgcaggtgctggtcgagcagtggatcagcggcccggaattcaccgtggcg
accttgcgcgggcaggtgctgccggcgatccgcctgggcacgccgcacaccttctacgac
tacgacgccaagtacctggccagcgatacccgctaccaggtgccctgcggtctcgacgag
gccaaggaacgcgagctgaaggaactcaccgcgcgcgcctgcgacgccctgggcatccag
ggctgggggcgggcggacgtgatgcaggacgccgaagggcgtttctggctgcttgaagtc
aacaccgcaccgggcatgaccgaccacagcctggtgcctatggccgcgcgggccgccggc
ctggatttccagcaactggtgctggcgatcctggccgatagccgcgaggcgaggggataa

DBGET integrated database retrieval system