KEGG   Paenibacillus sp. FSL R7-0273: R70723_04070Help
Entry
R70723_04070      CDS       T03356                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:paea00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    R70723_04070
Enzymes [BR:paea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     R70723_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
900064..902037
Genome map
AA seq 657 aa AA seqDB search
MGVDYYPEHWDESLWEEDMRLMKETGVRVVRVAEFAWSRLEPTEGRFEFAWLDRAIDLLH
SYGMQVVIGTPTATPPRWLTTAYPDVLPVFADGQVYHPGVRGHRCYNSTSLRMYGTRIVE
KLARHYSGHPAVIGWQTDNEFGMIDCHCDACNTAFRSWVQDKYGTLDRVNAEWGTVVWSG
EYSDWKELTVPYGGSKFQNPSLLLDFQRFQWDAVVKFQQTQLEVLRAECPGHFVTHNFHS
YPQRLDLYAVGADLDVASFDYYPNTSPDKQATTPYSGALSLDVTRGIKRSNFWIMEQLSG
PPGCWMPMWRTPHPGFIRAYAWQSIARGADTVVHFRWRSAVAGAEQYWHGLIDHSNVPGR
RFTEFAQLCSEVNQLSGKLKGTVLKHEVAILHSHEQKAALDIQPQAEGFDYYENIKLIHR
ALTKLGIGCDVVRAGEPLEGYKLVIAPSLYLLGEELAAQLEEFAIAGGTLILTNRTGVKN
LDNVCVMQPLPGLLSRAAGVWVHEYDPVGGDAHVIRDQESDTFACSQWCDLLTPVTAEPI
AWYNDDFYAGTPAITVNRFGKGEVYYFGTQVEERYWSGLLGGLAGRYGLRRFAGLPDGVQ
ASVRSGENGSLLFLLNLSRTEQAVPLDRDYRCAFNGEARSGLLLLAPYGVEILELEG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atcggtgttgactattaccctgagcattgggatgagtccctgtgggaagaggatatgcgg
ttaatgaaggaaacgggcgtgcgggtggtcagggtggctgaatttgcctggagcaggctt
gagccgacggaaggacgctttgagtttgcatggcttgaccgggcgattgatctgctccac
agctatggtatgcaggtagttatcggaacgcctacagcaacgccgccgcgctggctgaca
acggcgtatccggatgtactgccggtatttgctgacgggcaggtttatcatccgggtgtg
cgtgggcatcgctgttacaacagcacttcactgcgaatgtacggcacgcgcatcgttgag
aagctggcccggcattacagcggacatccggctgtaatcggctggcagactgacaatgag
ttcgggatgatcgactgccattgcgatgcctgcaatacagcgttccgcagctgggttcag
gacaagtacggcaccctggaccgggtgaacgccgagtggggaacggtggtgtggagcggg
gaatacagtgactggaaggagctgacggtaccgtatggcggatcaaagttccagaatccc
tcgctgctgctggatttccagcgcttccagtgggatgcggtagtgaagttccagcagacc
cagcttgaggtgctgcgcgctgaatgtccagggcatttcgttacacacaacttccacagc
tatccgcagcgcctggatctgtatgcggtcggtgcagatctggatgtggcctcctttgat
tattatccgaacacctcaccggataagcaggcgacgactccatacagcggggcgctgtcg
ctggatgtgacccgcgggatcaagcggagtaatttctggattatggagcagcttagcgga
cctccggggtgctggatgccgatgtggcgaacgccgcatcccggatttatccgcgcttat
gcgtggcagagcattgccagaggggcagatacggttgttcatttccgctggagaagcgcg
gttgcgggggccgagcagtactggcacgggctgattgaccacagcaatgtgccggggcgc
aggttcaccgaatttgcacagctgtgcagtgaggtgaatcagctaagcggaaagctcaag
ggaacggtactgaagcatgaagtagcaatcctgcattctcacgagcagaaggcagcactg
gatattcagccgcaggctgaagggttcgattactatgagaacatcaagctgattcaccgc
gccctgaccaagttgggcatcggctgcgatgtggtccgggcgggcgagccgctggagggc
tataagctggtcatcgcgccaagcctgtatctgcttggtgaagagctggcggcacagctg
gaggaattcgcgattgccggcggcaccctgatcctgacgaaccggacaggcgtgaagaac
ctggataatgtgtgcgtcatgcagccgctgcccggtcttctgagccgcgccgccggagtc
tgggtgcacgagtatgatccggtcggcggtgatgctcatgtaatcagagatcaggagagt
gacacctttgcctgtagccagtggtgcgatctgctgacaccggtgaccgccgagccgatc
gcctggtataatgatgatttctatgccggtacaccggctatcactgttaaccggttcggt
aaaggtgaggtttactactttggcacccaggtcgaggaacgttactggtccgggctgctt
ggcggcctggccggcaggtacgggctccggcgcttcgccggtctgccggacggagtccag
gcttcggtgcgcagcggggagaacggcagcttactgttcctgctgaatctgagccggacg
gagcaggctgtaccgctggaccgggattaccgctgcgcgtttaacggagaggcacgctcg
ggcctgctgctgcttgcaccttacggggtggagattctggagctggaagggtag

DBGET integrated database retrieval system