KEGG   Paenibacillus sp. FSL R7-0273: R70723_10590Help
Entry
R70723_10590      CDS       T03356                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00020  Citrate cycle (TCA cycle)
paea00480  Glutathione metabolism
paea01100  Metabolic pathways
paea01110  Biosynthesis of secondary metabolites
paea01120  Microbial metabolism in diverse environments
paea01130  Biosynthesis of antibiotics
paea01200  Carbon metabolism
paea01210  2-Oxocarboxylic acid metabolism
paea01230  Biosynthesis of amino acids
Module
paea_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paea_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paea00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R70723_10590
  Metabolism of other amino acids
   00480 Glutathione metabolism
    R70723_10590
Enzymes [BR:paea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     R70723_10590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ46276
UniProt: A0A089KAW0
LinkDB All DBs
Position
2390999..2392294
Genome map
AA seq 431 aa AA seqDB search
MLKLEKYDLPTEGEQITIEDGKLVVPANPIIPFIEGDGTGRDIWKASKRVLDAAVDKAYG
GEKKLAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKHPELVDMVIFRENTEDIYAGIEYKEGSEEVKKVIEFLK
KEMGVNKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDKVFTWNQYDVIKEKDGEAAANAAQKEAEAAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMTTAINNKTVTYDFARQMEGATELKC
SAFADEIIKHL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactcgagaagtacgatctgccgactgaaggcgaacaaattacgattgaagat
ggcaagctggtggttcctgctaatccgattattccgtttatcgaaggcgacggcacaggg
cgcgacatctggaaagcctccaagcgcgtgctggatgcagctgtagataaagcatacggc
ggcgagaagaagctggcctggtacgaagtgtttgccggcgagaaggccttcaatacatat
ggtgaatggctgccgaatgatacgctggaagcaatccgtgagtatatcgtagcgatcaag
ggaccgctgacaaccccgattggcggagggatccgctctttgaacgtggcgctgcgccag
gagctggatttgtacgtgtgcctgcgtcctgtacgttattttgacggcgtgccttcaccg
gttaagcatccggagcttgtggatatggttattttccgggaaaacactgaagacatctat
gccggtatcgagtacaaggaaggctctgaggaagttaaaaaagtaatcgaattcctcaag
aaggaaatgggcgttaacaaaatccgcttcccggaaacctccggtatcggtattaagcct
gtatcctccgaaggctccaagcgtctggtgcgtgctgcagttgaatatgcaatcaagcac
ggacgcaagagcgttaccctagtgcataagggcaacatcatgaagtttaccgaaggcgcg
tttaagaactggggatacgaagtggctgagcaggagttcggcgacaaggtgtttacctgg
aaccaatatgatgtaattaaagagaaggacggcgaagcggcggcaaatgcagcccagaag
gaagcggaggcagccggtaaaatcattatcaaggatgctatcgcagacatcgcgctgcag
caggtgctgacccgcccgactgacttcgacgttatcgctacactgaacctgaacggggac
tacctgtccgacgcactggctgcacagatcggcggtatcggcattgcaccgggagcgaat
atcaactatgtgaccggacatgcaatctttgaagcgactcacggcacggcgcctaagtac
gctgacaaagacgttgttaacccgggatcggttatcctctccggcgttatgctgcttgag
cacctcggctggcaggaagcggctgacctgatctacaaaggcatgactaccgcaattaac
aacaagacggtaacctatgactttgcccgccagatggaaggcgcgacagagctgaaatgc
tcggcctttgctgacgaaattattaaacatctgtaa

DBGET integrated database retrieval system