KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_0680Help
Entry
NCGM1900_0680     CDS       T03789                                 

Gene name
tufB
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Brite
Translation factors [BR:paeb03012]
 Eukaryotic Type
  Elongation factors
   NCGM1900_0680 (tufB)
 Prokaryotic Type
   NCGM1900_0680 (tufB)
Mitochondrial biogenesis [BR:paeb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NCGM1900_0680 (tufB)
Exosome [BR:paeb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCGM1900_0680 (tufB)
  Exosomal proteins of breast cancer cells
   NCGM1900_0680 (tufB)
  Exosomal proteins of colorectal cancer cells
   NCGM1900_0680 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
711290..712492
Genome map
AA seq 400 aa AA seqDB search
MVSMAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEK
ARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTR
EHILLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALM
ALEGKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVER
GIIKVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLA
KPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPG
DNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtctccatggctaaagaaaaatttgaacggaacaagccgcacgtcaacgtcggcacc
atcggtcacgttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctcc
gacacctggggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaag
gcccgcggtatcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactac
gcacacgttgactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcc
cagatggacggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgc
gagcacatcctgctgtcccgtcaggtaggcgttccctacatcgtcgtgttcctgaacaag
gccgacatggtcgacgacgccgaactgctggaactggtcgagatggaagttcgcgatctg
ctgaacacctacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatg
gcgctggaaggtaaagatgacaacggcatcggcgtaagcgccgtgcagaagctggtagag
accctggactcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccg
atcgaagacgtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgc
ggcatcatcaaggtccaggaagaagtggaaatcgttggcatcaaggcgaccactaagacc
acctgcaccggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaac
gttggtatcctgctgcgcggcaccaagcgtgaagacgtagagcgtggtcaggttctggcc
aagccgggcaccatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaag
gaagaaggtggtcgtcacactccgttcttcaagggctaccgtccgcagttctacttccgt
accaccgacgtgaccggtaactgcgagctgccggaaggcgtagagatggtaatgccgggc
gacaacatcaagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgc
ttcgcgatccgcgaaggcggccgtaccgttggtgccggcgtggttgccaagatcatcgaa
taa

DBGET integrated database retrieval system