KEGG   Paenibacillus sp. FSL H7-0357: H70357_04690Help
Entry
H70357_04690      CDS       T03358                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:paeh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    H70357_04690
Enzymes [BR:paeh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     H70357_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1009543..1011525
Genome map
AA seq 660 aa AA seqDB search
MQVGVDYYPEHWDESLWAADIQLMKETGVKVVRVAEFAWSRLEPREGTFDFAWLDRAMEL
FHQYGLQVVIGTPTATPPRWLTTTYPDVLPVFADGQTFHPGVRGHRCYNSASLREYGSRI
IEKLARHYSGHPAVIGWQTDNEFGMIDCHCETCNEAFRSWVRQKYGTLENVNAAWGTVVW
SGEYSDWNELTVPLGGSPFQNPSFLLDFQRFQWDSVVRFQKTQIDILRRICPEHFITHNF
HSYPQRLDMYAVGTDLDVAAFDYYPNTSPDKQETTPYSGALSLDVTRGIKRQNFWIMEQL
SGSPGCWMPMWRTPYPGFIRAYAWQAIARGADTIVHFRWRSAVAGAEQYWHGLIDHSNVP
GRRFAEFSQLCGEVNGLSGRLQGTVLKHEVAILHSHEQKAALDIQPQAGGLDYYGNIKQV
HRALTKLGIGCDVIRAGEPLGGYKIVIAPSLYVLDEMLAEQLEAYAAAGGLLLLTNRSGV
KDSNNICVMQPLPGLLSRAAGVRVDEYDPVGLEIHTLVDPEGNSFECSQWCDLLTPVTAV
PVAWYGDDFYAGIPAVTVNSFGKGQVYYFGTHAEERYWSLLLADLAGKYGVTRFAGLPDG
VQATIRSGENGSFLFLLNLNRMPQTVPLPGSYPSVLYNGEIRSGELRMEAYGVEILELAE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtcggcgttgattattacccggaacactgggatgagtccttgtgggcggcggat
attcagttaatgaaggaaaccggggtcaaggtggtccgggttgctgaattcgcctggagc
cgtttggagccaagggaaggaacctttgattttgcctggctggaccgggctatggagctg
ttccatcagtacggattgcaggtagtgatcggcacaccaaccgccactccgccgcgctgg
ctgactacaacatatccggatgttcttccggtctttgccgatgggcagacgttccatcct
ggcgtgcgcgggcaccgttgttataacagcgcttccctgcgggaatatggcagccggatt
atcgaaaagctggcccgccattacagcggtcatcctgctgtgatcggctggcagaccgac
aatgaattcggcatgattgactgccactgcgagacttgcaatgaagctttccgcagctgg
gttaggcaaaagtacggcacgctggagaacgtgaacgcagcatggggaacggtagtttgg
agcggggagtacagcgactggaatgagctgacggtaccgctgggcggctcgccgttccag
aatccgtcgttcctgctggattttcagcgttttcaatgggattcggttgtccggttccag
aagacgcagattgatattctgcggaggatttgcccggagcattttattacccataacttt
cacagttatccgcagcggctggatatgtatgcagtgggcaccgacctcgatgtggcggca
ttcgactattatccgaacacctcaccggacaaacaagagacaacgccctatagcggagcg
ctgtctctggacgtcactcgcgggattaaacggcagaacttctggatcatggagcagctc
agtggctcaccgggctgctggatgccgatgtggcggacaccgtatccgggttttatccgc
gcctatgcctggcaggcgattgccagaggagcggatacgatcgtgcattttcgctggaga
agtgctgtcgccggggccgagcaatattggcatggcctgattgatcacagcaatgtgccg
ggccgccgattcgccgagttcagccagctctgcggagaagtaaacggcctcagcggcagg
ctgcaggggactgtgctgaagcatgaagtggcgattctgcattcccatgagcagaaggcc
gcgctggacatccagccacaggccgggggtctggactattacgggaacatcaagcaggtt
caccgggcacttacgaagctcgggattggctgcgatgtaatccgtgccggggaaccgctg
ggcggctataaaattgtcatcgcaccaagcctgtacgtgctggacgagatgcttgcggag
cagcttgaagcttatgcggcggcaggcggtctactccttctgacgaaccgcagcggcgtt
aaggacagtaacaacatctgcgtcatgcagccgctgccgggattgttaagccgtgcagca
ggtgtccgggttgacgaatatgatcccgtcggcctggaaatccataccctagtggaccct
gaagggaactccttcgaatgcagccagtggtgcgatctgctgacgccggtcacggcggtg
cctgtcgcctggtacggcgatgatttctacgccggaattccggctgtcactgtcaacagc
ttcgggaaagggcaggtgtattacttcggaacccatgccgaagaacgctactggtcactg
ctgctggccgatttggccggtaagtacggagtaacccgctttgccggtctgccggatggc
gtacaggccacaatccgcagcggagagaacggcagcttcctgttcctgctgaacctgaac
cggatgccgcaaaccgtgccgctgccgggcagttaccctagcgtgctctataacggtgag
atccgctcgggcgagctgcggatggaggcttacggggtggagattctggagctggcggag
tag

DBGET integrated database retrieval system