KEGG   Paenibacillus sp. FSL H7-0737: H70737_09200Help
Entry
H70737_09200      CDS       T03359                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00020  Citrate cycle (TCA cycle)
paej00480  Glutathione metabolism
paej01100  Metabolic pathways
paej01110  Biosynthesis of secondary metabolites
paej01120  Microbial metabolism in diverse environments
paej01130  Biosynthesis of antibiotics
paej01200  Carbon metabolism
paej01210  2-Oxocarboxylic acid metabolism
paej01230  Biosynthesis of amino acids
Module
paej_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paej_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paej00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H70737_09200
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H70737_09200
Enzymes [BR:paej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H70737_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ23014
UniProt: A0A089JPW7
LinkDB All DBs
Position
2094867..2096162
Genome map
AA seq 431 aa AA seqDB search
MLKLEKFDLPTEGEQITIKEGKLQVPNNPIIPFIEGDGTGRDIWKASKRVLDAAVTKAYG
GTKQIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYFVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFQGVPSPVKRPELVDMVIFRENTEDIYAGIEYQEGSAEVKKVIEFLQ
KEMGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIEYAIKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDKVFTWSQYDVIKERDGEAAANAAQKDAEAAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYITGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMETAINNKTVTYDFARLMEGATELKC
SAFADEIINHL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactagaaaaattcgatctacctacagaaggcgaacaaatcacgattaaagaa
ggaaaactacaagttccgaataatccaatcattccttttatcgagggtgacggtacaggc
cgtgatatttggaaagcttccaagcgcgtacttgatgcagcagtaactaaagcttatggt
ggcactaagcaaatcgcttggtacgaagtatttgctggcgaaaaagctttcaatacatat
ggtgaatggttgccaaatgatacgttggaagcaatccgcgaatattttgtggcgatcaag
ggaccacttactactccaatcggaggcggtattcgttcattgaatgtagctttgcgtcaa
gaattggatttgtacgtatgtctgcgtccagttcgttatttccaaggtgtaccttctcct
gttaaacgtcctgagctggtggatatggttattttccgtgagaatacagaggatatctat
gcagggattgaatatcaagaaggctctgctgaagtgaagaaagtcattgaattcctgcaa
aaagagatgggagttaacaaaatccgtttccctgaaacttctggtattggtatcaaaccg
gtatcctccgaaggttcgaagcgcttggtgcgcgctgcaattgaatatgcaatcaaacac
ggacgtaagagtgtaacgcttgttcacaaaggaaacatcatgaagttcactgaaggtgcc
tttaaaaactggggttatgaagtagctgagcaagagttcggagataaggtcttcacttgg
agtcaatatgatgtgattaaggaacgtgacggtgaggctgccgctaatgctgctcagaag
gatgctgaagctgctggcaaaatcattatcaaggatgcaattgcggatatcgcgctgcaa
caagttctgactcgtccaactgatttcgatgttattgctacgttgaacctgaacggggat
tacctgtccgacgcactggctgcacaaatcggcggcatcggcatcgctcctggagcgaac
attaactacattactggccacgccatctttgaagctacccatggtacagctcctaaatat
gcagacaaagacgttgtgaatcctggttctgtcattctgtccggcgtaatgctcttggag
cacttgggctggcaggaagcagcggacctgatttataaaggtatggaaactgctatcaac
aataagaccgtgacttatgactttgcccgcctgatggaaggtgcaactgagctgaaatgc
tccgcatttgcagacgaaattattaaccacctatag

DBGET integrated database retrieval system