KEGG   Pseudomonas aeruginosa LES431: T223_03750Help
Entry
T223_03750        CDS       T02970                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00473  D-Alanine metabolism
pael00550  Peptidoglycan biosynthesis
pael01100  Metabolic pathways
pael01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pael00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    T223_03750
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T223_03750
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    T223_03750
Enzymes [BR:pael01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     T223_03750
Peptidoglycan biosynthesis and degradation proteins [BR:pael01011]
 Precursor biosynthesis
  Amino acid ligase
   T223_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AHC63413
LinkDB All DBs
Position
791150..792175
Genome map
AA seq 341 aa AA seqDB search
MKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLASKVKE
VPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAYTGSGH
LASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTVGLSIV
HSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFDYEHKY
QAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEVNTLPG
MTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggacgtctccatcgccagc
ggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtgctggcggtggatacc
gccagcggcctgctcggcgcggaggaagagcgccgcctgctggcgagcaaggtcaaggag
gtcccgccggactccgactcgctggcgatcatccgcagcggcaagcagagcctgctgagc
gccggcgaactggctggggtcgacgtgttcttcctcgccctgcacggcggcaccggcgag
gacggcaccctgcaggcgctgctggatgccggcggtttcgcctataccggcagcggccac
ctggccagcgccatggcgatggacaaggacgtggccaagcgcctgttcctcgccgccggg
gtggagaccgccagttggctgatggcgccggcctcggaagaggcggtgcgcgagcaactg
ggcttccccctggtggtcaagccgaacagccagggctccaccgtggggctgtccatcgtg
cattcccaggccgaattgcagccggccatcgagctggccgggcgctatggcgacgaggtg
atgctggagcgcttcgtcgccggccgcgaggttaccgtcggggtgctcgacgaccaggcg
ctgccggtgggcgagattctcctcggtggccaggaagtcttcgactacgaacacaagtac
caggccggcgcggtgcgcgaggtgtttcctgccgacctgccgccggcgatcgccgccgag
gcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagcggctacagccgcacc
gacttccgcctcgacgaacagggccggctctggtgcctggaggtcaataccctgccggga
atgaccgccaccagcctgctgccgcaggccgcggcggcggccgggattgggttcgccgaa
ctctgcgagcggatctgccggctcggtatcgagcgctgcaagggcgcgcgcaaggcgcgt
tcctga

DBGET integrated database retrieval system