KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4633Help
Entry
PA1R_gp4633       CDS       T02929                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paer  Pseudomonas aeruginosa PA1R
Brite
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PA1R_gp4633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AHA26338
LinkDB All DBs
Position
complement(5177703..5178344)
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLDQRLADRAFVAGNDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccaccccgaacggccacaagattactcttttcctggaa
gaaaccggcctgccctacgccatccatccgatcaatatcagccagggcgaccagttccag
gcggatttcctgaaggtgtcgccgaacaacaagattcccgccatcgtcgatcgccaacca
gccgacggcggcgctcccctgtcgctgttcgagtccggcgccatcctgctctatctcgcg
gaaaagaccggacggttcctcgccaaggacctgcgcgcgcgccaggaaaccctgcagtgg
ctgttctggcagatgggcgggctggggccgatggccgggcagaaccaccatttcaaccgc
ttcgccccggagaagattccctacgccatcgaccggtacgtcaaggaaaccgcgcgcctg
tacggcgttctcgaccagcgcctggcggaccgcgccttcgtcgccggcaacgactacagc
atcgccgacatggccatctatccgtggatcgtcccacaccagtggcaggagcaggatctc
gccgacttcccgcacctgcagcgctggttcgagagcattcgccagcgtccggcgacgcaa
cgcgcctatgctttggtggagcgcatcaatccgccgcagtag

DBGET integrated database retrieval system