KEGG   Pseudomonas aeruginosa PA38182: BN889_02650Help
Entry
BN889_02650       CDS       T03031                                 

Gene name
pvdL_2
Definition
(GenBank) peptide synthase
Organism
paeu  Pseudomonas aeruginosa PA38182
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2782076..2792674)
Genome map
AA seq 3532 aa AA seqDB search
MRGGRDDCFRDSLELDCKPNSGRKTHDGRLELPTTLVQALRRRAVQEPERLALRFLAEDD
GEGVVLSYRDLDLRARSIAAALQAHAQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAY
PPESARRHHQERLLSIIADAEPRLVLTTADLREPLLQMNAQLSAANAPQLLCVDLLDPAV
AEAWDEPQVRPEHIAFLQYTSGSTALPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWL
PLYHDMGLIGGLLQPIFSGVPCVLMSPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCS
ERVAESALQRLDLSGWRVAFSGSEPIRQDSLERFAEKFAASRFDASSFFACYGLAEATLF
VTGGQRGQGIPALAVDGEALARNRIAEGEGSVLMCCGRSQPEHAVLIVDAASGEVLGDDN
VGEIWAAGPSIAHGYWRNPEASAKTFVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIV
RGHNLYPQDIERTVESEVPSARKGRVAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELID
SIRQAVAEAYQEAPKVVALLNPGALPKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQ
EAQPPAGDDELLARIGEIWKARLGVAQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALD
LRQLFEAPTLQAFSATVARQLAAGLPAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSA
AYNIPGGLRLRGELDEAALRASFQRLVERHEALRTRFLERDGAALQRIDERGEFAWQFVD
LAALAEHERAAAAAQRREAEAQQPFDLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWS
LNLLLDEFSRLYAEACGGQPADLAPLELHYAEFAAWQRQWLDAGEGARQLAYWRECLGDA
APVLELATDHPRTARQASPAARYSLRVDEALARAIREAALDHEASVFMWLLAAFQALLHR
HSGQGEIRIGVPSANRQRLETQGLVGFFINTLVLRGTPRARQPFAALLGEAREATLGAQA
NQDLPFDQVLAACGQGGQLFQVLFNHQQRDLSALRRLPGLLADELPWHSREAKFDLQLQS
EEDARGRLTLNFDYAADLFDEASIRRFAAQYLELLRQVAEDPQRCLGDIALVDAEQAAHL
AEWGSAPCEPARAWLPELLERQLAQSAERVALEWDGGSLGYAELHARANRLAHYLRDKGV
GPDVRVAICAERSPQLLVGLLAIVKAGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHL
FERLPGAEGVTPICLDSLKLDNWPSQAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAAL
AERLQWMQATYALDGDDVLMQKAPVSFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVE
LVRQFEVTTLHFVPPLLQLFIDEPGVAACGSLRRLFSGGEALPAELRNRVLQRLPAVALH
NRYGPTETAINVTHWQCRAEDGERSPIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLG
LARGYLGRPALSAERFVADPFSADGERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRI
EPEEIQARLLAQPGVAQAVVVIREGVAGSQLVGYYTGAVGAEAEAEQNQRLRAALQAELP
EYMVPAQLMRLAQMPLGPSGKLDTRALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPR
VGLRDDFFELGGHSLLATRIVSRTRQACDVELPLRALFEASELEAFCEQVRAAQAAGRTD
SHGAIRRIDREQPVPLSYSQQRMWFLWQLEPDSPAYNVGGLARLSGPLDVARFEAALQAL
VQRHETLRTTFPSVDGVPVQRVHSDGGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFD
LESGPLLRVCMVKMAEREHYLVVTLHHIVTEGWAMDIFARELGALYEAFLDDRESPLEPL
PVQYLDYSVWQREWLESGERQRQLDYWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFD
LSPELAERVRRFNAARGLTMFMTMTATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIG
AFLNTQVLRCRLDGQMSVGELLEQVRQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQ
VMCNVQRWEFQQTRQLAGMTVEYIANDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEP
RIARMAGHWQNLLEALLGDPQRRIAELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAAR
VAASPQAPALTFAGQTLSYAELDARSNRLARVLRSHGVGPEVRVGLALERSLEMVVGLLA
ILKAGGAYVPLDPEYPLERLQYMIEDSGVRLLLSHAALFEALGELPAGVARWCLEEDGPA
LDAEDPAPLAALSGPQHQAYLIYTSGSTGKPKGVAVSHGEIAMHCAAVIERFGMRAEDCE
LHFYSINFDAASERLLAPLLCGARVVLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQL
AQWLESQGRQLPVRMCITGGEALTGEHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPE
RLEEGAASVPIGSVVGARVAYILDADLALVPQGATGELYVGGAGLARGYHERPALSAERF
VPDPFAAEGGRLYRTGDLVRLCDNGQVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVR
EALVLALDSPSGKQLAGYVASAVAEQDEDAQAALREALKTHLKQQLPDYMVPAHLLLLAS
LPLTANGKLDRRALPAPDPALNRQAYEAPRSMLEQQLAGVWREVLNVERVGLGDNFFELG
GDSILSIQVVSRARQLGIHFSPRDLFQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPI
QHWFFDLPLARREHWNQSLLLQPRQAIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQ
HRPLREQELLWHVPVQSFDECAELFAKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHH
LVVDGVSWRVLLEDLQQVYRQFAEGAEPALPAKTSAFRDWAGRLQAYAGSESLREELGWW
QARLGGQPVEWPCDRPQGDNREALAESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTAL
ARVLCRWSGQPSTLVQLEGHGREALFDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIK
EQLRAVPHKGLGYGVLRYLADPAVRQAMAALPTAPITFNYLGQFDQSFADALFQPLDQPT
GPIHDEQAPLPNELSVDGQVYGGELVLRWTYSRERYDAQTVNELAQAYLAELQALIEHCL
EDGAGGLTPSDFPLAQLSQAQLDALAVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYM
QDRYRIDSPLDPERFAAAWQAVVARHEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSE
LPEDGHEERLQALHKREREAGFDLLEQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGL
LMNDFFEIYGALGEGRPANLPTPPRYRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPS
DRPFLREHAGESGGMIVGDRYTRLDAADGARLRELAQRYQLTVNTFARPPGR
NT seq 10599 nt NT seq  +upstreamnt  +downstreamnt
ttgaggggcggccgcgacgactgtttccgggactcactagaactcgattgcaagccgaat
tcaggcaggaaaacacatgatggacgcctcgaacttcccaccaccctggtccaggccctg
cgtcgccgcgctgtccaggagcccgagcgcctggcgctgcgcttcctcgccgaggacgat
ggcgaaggcgtggtcctcagctatcgcgatctcgacctgcgcgcgcggagcatcgctgcg
gccctgcaggcccatgcgcagctgggcgatcgcgcggtactgctgtttcccagcggcccc
gactacgtcgcggcgttcttcggttgcctgtatgccggggtcatcgcggtgccggcctac
ccgccggaatcggcgcgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgcc
gagccgcgcctggtcctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcg
caactgtccgccgccaacgccccgcaactgctctgcgtcgacctgttggacccggccgtt
gccgaggcctgggacgagccgcaagtgcgtcccgagcacatcgccttcctccagtacacc
tccggttcaaccgcattgcccaagggcgtgcaggtcagccatggcaacctggtcgccaac
gaggtgctgatccgccgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctg
ccgctgtaccacgacatgggcctgatcggcggcctgctgcaaccgatcttcagcggcgta
ccctgcgtgctgatgtcgccgcgctacttcctcgaacgtccggtgcgctggctggaagcc
atcagccagtacggcggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagc
gagcgggtcgccgagtcggccctgcagcgtctcgacctgagcggttggcgggtagccttc
tccggttccgagccgatccgccaggacagcctggaacgcttcgccgagaaattcgccgcc
agccgcttcgatgcgtccagtttcttcgcctgctacggcctcgccgaggcgaccctgttc
gtcaccggcggccagcgcggccagggcattcccgccctggcggtggatggcgaggcgctg
gcgcgcaaccgcatcgccgaaggcgaaggcagcgtgctgatgtgctgcggccgcagccag
ccggaacacgccgtgctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaac
gtcggcgagatctgggccgccgggccgagcatcgcccacggctactggcgcaacccggaa
gcttcggcgaagaccttcgtcgagcgtgacgggcgcacctggctgcgcaccggcgacctc
ggcttcctccgcgacggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtc
cgcggccacaacctctatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcg
gcgcgcaagggcagggtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggc
atcgccgccgagatcggtcgcggcgtccagaaatcggtgccggcccaggagctgatcgac
tcgatccgccaggcggtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctc
aatcccggcgccttgccgaagacgtccagcggcaagctgcaacgttccgcctgccgcctg
cgcctggaagacggcagcctggacagctatgcgctgtttcccggcctccaggccgtgcag
gaggcgcagccgccggcaggcgacgacgaactgctggcacgcatcggcgagatctggaag
gcccggctgggcgtggcgcaggtagcgccgcgcgatcacttcttcctgcttggcggcaat
tccatcggcgccgcccaggtggtcgcccaggtgcgcgacagtctcggcgtcgccctcgac
ctgcgccaactgttcgaggcgccgaccctgcaggccttcagcgccacggtggcccgccaa
ctggccgccggcctgccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctg
ccgcagtcggcggcgcagcagcgtctctggctgacctggcagatcgatccgcagagcgcc
gcctacaacatccccggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgc
gccagcttccagcgcctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgc
gacggcgcggccttgcagcgtatcgacgagcggggcgagttcgcctggcagttcgtcgac
ctcgctgcgctggccgagcacgaacgcgccgcggctgccgcgcagcgccgcgaagccgag
gcgcagcagccgttcgacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctg
gacgaacaggagcaccagctctgggtcaccctgcatcacatcgtcgccgatggttggtcg
ctgaacctgctgctcgacgaattctcgcggctctacgccgaagcctgcggcggccagccg
gccgacctggcgccgctggaactgcactacgccgagttcgccgcctggcaacggcagtgg
ctggacgcgggcgagggcgcccgccaactggcctactggcgggagtgcctgggcgacgcg
gcgccggtgctggaactggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgcc
gcgcgctacagcctgcgggtcgacgaagccctggcgcgggctatccgcgaggccgcgctg
gaccatgaggcgagtgtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgc
cacagcgggcagggcgagatccgcatcggcgtgcccagcgccaaccgccagcgcctggag
acccaggggctggtcggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcg
cgccagccgttcgccgcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggcc
aaccaggacctgccgttcgaccaggtgctcgcggcctgcggccagggcggccagttgttc
caggtgctgttcaaccaccagcagcgcgacctgtcggcgttgcgccggctgcccggcctg
ctcgccgacgagctgccctggcacagccgcgaagccaagttcgacctgcaactgcagagc
gaggaggacgctcgcggtcgcctgaccctgaatttcgactacgccgcggacctcttcgac
gaggccagcatccggcgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaa
gacccgcagcgctgcctcggcgatatcgccctggtcgacgccgagcaggcggcgcacctc
gccgaatggggcagcgcgccctgcgagccggcgcgcgcctggctgccggagctgctggag
cggcaactggcgcagtccgccgaacgcgtcgccctggagtgggacggcggcagcctcggc
tacgccgaactgcacgcccgggccaaccgcctggcccactacctgcgcgacaagggcgtc
ggcccggacgtgcgggtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctg
ctggcgatcgtcaaggcgggcggcgcctacgtgccgctggacccggactaccccagcgaa
cgcctggcctacatgctcgccgacagtggcgtcgagctgctgctgacccaggcccatctg
ttcgagcgcctgcctggcgcggagggcgtcacgccgatctgcctggacagcctcaagctc
gacaactggccgagccaggcaccgggcctgcacctgcacggcgacaatctcgcctacgtc
atctacacctccggctccaccggccagccgaagggcgtgggcaacacccacgcggcgctg
gccgagcgcctgcaatggatgcaggccacctacgccctcgacggcgacgacgtgctgatg
cagaaggcgccggtgagcttcgacgtgtcggtgtgggagtgcttctggccgctggtcacc
ggttgccggttggtcctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaa
ctggtgcggcagttcgaggtgaccacgctgcacttcgtgccgccgctgctgcaactgttc
atcgacgaacccggcgtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgag
gcgcttccggcggagctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcat
aaccgctacgggccgaccgagaccgccatcaacgtcacccattggcagtgccgcgcggaa
gacggcgagcgttcgccgatcggccggccgctgggcaacgtggtctgccgcgtgctggac
gccgagttcaacctgctgccggccggcgtcgccggcgagttgtgcatcggcggcctgggc
ctggcccgtggctacctggggcgcccggcgctgagcgccgagcgcttcgtcgccgatccg
ttctcggccgacggcgagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgac
ggggtgctggaatacctcggtcgcctcgaccagcaggtcaagctgcgtggcttccgcatc
gagccggaggagatccaggcacgcctgctggcgcagccgggggtggcccaggcggtagtg
gtgatccgcgaaggcgtggccggcagccagttggtcggctactacactggcgctgtcggc
gccgaggcggaagccgagcagaaccagcgtctgcgcgccgcgctacaggccgaactgccg
gaatacatggtcccggcgcagttgatgcgcctggcgcagatgcccctcggcccgagcggc
aagctggatacgcgggcgctgccggagccggtctggcagcagcgcgagcacgtcgagccg
cggaccgagctgcaacggcgcatcgccgcgatctggagcgaagtgctcggcctgccgcgg
gtcggcctgcgcgacgatttcttcgaactcggcgggcattccctgctggccacccgcatc
gtctcgcgcacccgccaggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggcc
agcgaactggaggccttctgcgaacaggtccgcgcagcccaggccgccggacgtaccgac
agccacggcgcgatccgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcag
cagcgcatgtggttcctctggcaactggagccggacagcccggcctacaacgtcggcggc
ctggcacgcctgagcgggccgctggacgtggcgcgcttcgaggccgcgctacaggccctg
gtgcagcgccacgagaccctgcgcaccacgttccccagcgtcgacggcgtgccggtacag
cgcgtacatagcgatggcggcctgcacatggactggcaggacttctccgcgctcgaccgc
gacagtcgccagcagcacctgcagaccctcgccgacagcgaggcgcaccggcccttcgac
cttgagagcgggccgttgctgcgggtctgcatggtgaagatggccgagcgcgagcactac
ctggtggtgaccctgcaccacatcgtcaccgaaggctgggcgatggacatcttcgcccgc
gaactgggcgcgctctacgaggccttcctcgacgaccgcgaatcgccgctggagccgttg
ccggtccagtacctggactacagcgtgtggcagcgcgagtggctggagagcggcgagcgc
cagcgccagctcgactactggaaggcccagctgggcaacgagcatccgctgctcgaactg
ccgggcgaccggccacgcccgccggtgcagagccaccagggcgacctctaccgcttcgac
ctgagccccgagctggccgagcgcgtgcgccgcttcaacgccgcccgcgggctgaccatg
ttcatgaccatgaccgccacccttgcggccttgctctaccgctacagcggccagcaggac
ctgcgtatcggcgcgccggtggcgaaccgcatccgcccggagagcgaagggctgatcggc
gccttcctcaatacccaggtgctgcgctgccggctcgacggacagatgagcgtcggcgag
ctgcttgagcaggtgcggcagaccgtgatcgatggccagtcgcaccaggacctgccgttc
gaccacctggtggaagccctgcagccgccgcgcagcgccgcctacaacccgttgttccag
gtgatgtgcaacgtccagcgctgggagttccagcagacccggcaactggccgggatgacc
gtcgagtacatcgccaacgatgcgcgggcgaccaagttcgacctcaacctggaggtcacc
gacctcgaccagcgcctcggctgctgcctgacctacagccgcgacctgttcgacgaaccg
cgcatcgcgcggatggccggacactggcagaacctgctggaggcgctgctgggcgacccg
cagcggcgcattgccgaattgccgctgttcgccgccgaggagcggaagcaactgctgctc
gccggcacggccggcgaggcagggctccaggacaccctccatggcctgttcgccgcccgc
gtggcggccagcccccaggccccggcgctgaccttcgccgggcagaccctgagctatgcc
gaactcgatgcccgctccaaccgtctggcgcgcgtcctgcgcagtcacggcgtcggcccg
gaagtgcgggtcggcctggccctggagcgttcgctggagatggtcgtcggcctgctggcg
atcctcaaggccggcggcgcctacgtgccgctggacccggaatatccgctggagcgcctg
caatacatgatcgaggacagcggcgtacgcctgctgctcagccacgcggcgctgttcgag
gccctcggcgagctgccggcaggcgtggcgcgctggtgcctcgaggaggacggcccggcg
ctggacgccgaggaccccgcgccgctggcagcgctgagcgggccgcagcaccaggcctac
ctgatctatacctccggctccaccggcaagccgaagggcgtggcggtctcccacggcgag
atcgccatgcactgcgccgcggtgatcgagcgcttcggcatgcgcgccgaggattgcgaa
ctgcacttctattcgatcaacttcgacgccgccagcgagcgcctgctggccccgttgctg
tgcggcgcccgcgtggtgctgcgggcccagggccagtggggcgcggaggaaatctgcgag
ctgatccgcgcggagggcgtgagcatcctcggcttcaccccgagctacggcagccagctc
gcccagtggctggagagccagggccggcagttgccggtgcgcatgtgcatcaccggcggc
gaagcgctgaccggcgagcacctgcaacggattcgccaggccttcgccccggcgtcgttc
ttcaatgcctacggaccgaccgaaacggtggtcatgccgctggcctgcctggctcccgaa
cgactggaggagggcgccgccagcgtgccgatcggcagcgtggtcggtgcgcgggtcgcc
tacatcctggatgccgacctggccctggtgccgcagggcgcgaccggcgaactctacgtc
ggcggcgccggcctggcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttc
gtgcccgatcccttcgctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgc
ctgtgcgacaacggccaggtggaatatgtcggccgcatcgaccaccaggtgaagatccgt
ggcttccgcatcgaactgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgc
gaagcgctggtcctggcgctcgacagcccgagcggcaagcagttggccggttatgtcgcc
agcgcggtggccgagcaggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacg
catctcaagcagcaattgccggactacatggtgccggcccacctgctgttgctcgccagc
ctgccgctgaccgccaacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcg
ctcaaccggcaggcctacgaggccccgcgcagcatgctggagcagcaactggccggggtc
tggcgcgaggtgctgaacgtcgagcgggtaggtctcggcgacaacttcttcgaactgggc
ggcgattcgatcctgtcgatccaggtggtcagccgtgcccgccagctcggcatccacttc
agcccccgcgacctgttccagcaccagaccgtgcagagcctcgccgcggtggcccggcac
agccaggccagccaggccgagcaggggccggtgcagggcgacagcgcgctgacgccgatc
cagcactggttcttcgacctgccgctggcgcgccgcgaacactggaaccagtcgctgctg
ttgcagccgcggcaggccattgacctcggtctgctgcgcaagtccctgcaacgcctggtc
gaacagcatgatgccctgcgcctggcgttccgccaggtcgacggcgagtggctggcgcag
catcgtccgctgcgcgaacaggaactgctctggcacgttccggtgcaatccttcgacgaa
tgcgccgagctgttcgccaaggcccagcgcagcctcgacctcgaacaggggccgctgctg
cgcgcggtgctggtggacggcccggccggcgagcaacgcctgctgctggcgatccaccac
ctggtggtggacggggtgtcctggcgggtgctgctggaggacctgcaacaggtctaccgt
cagttcgccgagggcgccgaaccggcgctgccggccaagaccagcgccttccgcgactgg
gccggacgcctgcaggcctacgccggcagcgaatcgctgcgcgaggagctgggctggtgg
caagcccggctgggtgggcagccggtcgagtggccgtgcgaccgcccgcagggcgacaac
cgcgaggcgctggcggaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattg
ctgcaacaggcgccggcggcctaccgcacccaggtcaacgacctgctgctgaccgccctc
gctcgcgtgctctgccgctggagcgggcagccgtcgacgctggtgcagttggaagggcat
ggccgcgaggcgctgttcgacgatatcgacctgacccgcagtgtcggctggttcaccagc
gcctacccgttgcgcctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaag
gaacagctccgcgcggtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgcc
gatccggcggtgcgccaggcgatggccgcgctgcccacggcgccgatcaccttcaactac
ctcggacagttcgaccagagcttcgccgacgccctgttccagccgctggaccagcccacc
gggccgatccacgacgagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtc
tacggcggcgagctggtgctgcgctggacctacagccgcgagcgctacgacgcgcagacg
gtgaacgagctggcgcaggcctatctcgccgaactgcaggcgctgatcgagcattgcctg
gaagacggcgccggcggcctgaccccgtccgacttcccgctggcgcaactgagccaggcg
caactggacgccctggcggtgccggccggcgagatcgaggacgtctatccgctgaccccg
atgcaggaagggttgctgttgcacaccctgctggaaccgggcaccggcatctactacatg
caggaccgctaccggatcgacagcccgctcgatcccgagcgcttcgccgccgcctggcag
gcggtggtggcccgccacgaggcgctgcgcgcgtcgttcgtctggaatgctggcgaaacg
atgttgcaggtgatccacaagcccggtcgcacccgcatcgagttcctcgactggagcgaa
ctgccggaggacggccacgaggaacgcttgcaagcgctgcacaagcgcgagcgcgaggcc
ggcttcgacctgctcgaacagccgccgttccacctgcgcctgatccgcctgggcgaggcg
cgctactggttcatgatgagcaaccaccacatcctcatcgatgcctggtgccgtggcctg
ctgatgaacgacttcttcgagatctacggcgccctcggcgaaggccgcccggcgaacctg
ccgacgccgccgcgctaccgcgactacatcgcctggctgcaacgccaggacctggagcaa
tcgcgtcgctggtggagcgagagcctgcgcggcttcgagcggccgaccctggtacccagc
gaccgcccgttcctccgcgagcacgccggcgagagcggcgggatgatcgtcggtgaccgc
tacacgcgtctggacgccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccag
ctcaccgtcaacaccttcgccaggccgcctgggcgctga

DBGET integrated database retrieval system