KEGG   Pseudomonas aeruginosa LESB58: PLES_06511Help
Entry
PLES_06511        CDS       T00818                                 

Gene name
tufB
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
Translation factors [BR:pag03012]
 Eukaryotic Type
  Elongation factors
   PLES_06511 (tufB)
 Prokaryotic Type
   PLES_06511 (tufB)
Mitochondrial biogenesis [BR:pag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PLES_06511 (tufB)
Exosome [BR:pag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PLES_06511 (tufB)
  Exosomal proteins of breast cancer cells
   PLES_06511 (tufB)
  Exosomal proteins of colorectal cancer cells
   PLES_06511 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
707576..708769
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgaacggaacaagccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgacacctgg
ggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcacgatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgcccacgtt
gactgccccggtcacgccgactatgtgaagaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtgggcgttccctacatcgtcgtgttcctgaacaaggccgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggcaaggatgacaatggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaagtggaaatcgtcggcatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgcggcaccaagcgtgaagacgtagagcgtggccaggttctggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gtgaccggtaactgcgagctgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggtgctggcgtggttgccaagatcatcgaataa

DBGET integrated database retrieval system