KEGG   Pseudomonas aeruginosa LESB58: PLES_12971Help
Entry
PLES_12971        CDS       T00818                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PLES_12971 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PLES_12971 (ppc)
Enzymes [BR:pag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PLES_12971 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1407126..1409762
Genome map
AA seq 878 aa AA seqDB search
MPEIDARLREDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATL
DGLEEDELLPVARAFNQFLNLANIAEQYHRIRRRRPNEPEPFENLVLEELLGRLKDAGHA
PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL
QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLRSTGERLPL
TAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASPQ
LLARVGDNAEPYRALLKQLRERLRVTRNWTHQALAGEVPAAEGVLEHNRDLVEPLQLCHE
SLHACGMGVIADGALLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITEYLELGSYDEW
DEKTRLEFLLEELNSRRPLLPAHYQPSADTAEVLATCRAIAAAPPASLGSYVISMAGQPS
DVLAVQLLLKESGVDWPMRVVPLFETLDDLDNAGPCMERLLTLPGYRSRLSGVQEVMIGY
SDSAKDAGTLTAAWAQYRAQEKLVEICRQHEVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRVTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLMPPPAPEPAWRAQMDRLA
KDALLAYRRVVRDDPQFVEYFRLATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWETALLNAIERGEGALLGQMRERWPFFTTRIDMLEMVLAKADADIARLY
DERLVPLELRPLGRRLRDLLSQAVRVVLGLTGQSLLLAHASETRESISVRNSYLDPLHLL
QAELLARSRRCRGDACGGLEQALLVTVAGVAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatcgatgcgcgcctgcgcgaggacgtccaccaactgggcgaattgctcggc
gacaccatccgcgagcagtacggcccgcggttcctcgacaagatcgagctgatccgcaag
ggcgccaaggctgcccgccgcggttccgcggagggcgcccagcagctcaccgccaccctc
gacgggctcgaggaagacgaactgctgccggtggcgcgggccttcaaccagttcctcaac
ctggccaatatcgccgagcaataccaccgtatccgccggcgccggccgaacgagccggaa
cccttcgagaacctggtgctggaagagctgctggggcgtctcaaggacgccgggcatgcc
cccgggcaactggctcgccagctcgccgggctggagatcgaactggtgctgaccgcccat
cccaccgaggtggcgcggcgcacgctgatccagaaatacgatgcgatcaccgcgcagctg
gcggccaaggaccatgccgacctgctgccggaggagcgcagtcgcatccagcagcgcctg
cagcggctggtggccgaggcctggcataccgacgagatccgcaaggtccggccgaccccg
gtggacgaggcgaaatggggcttcgcggtgatcgaacattctctctggcaggccttgccg
aacgtccttcggcacgtcgacgaggtactcctgcgcagcaccggcgaacgcctgccgttg
accgccgcgccgctgcgcttcgcgtcctggatggggggcgaccgcgacggcaatcccaac
gtcaccgccagcgtgacccgcgaggtcctgctgctggcgcgctggatggccgccgacctg
tacctgcgcgatatcgaccgactggccgccgagctgtccatgcagcaggcctcgccgcag
ctgctggcgcgggtcggcgataacgctgagccctatcgcgccctgctcaagcaattgcgc
gagcgcctgcgcgtgacccgcaactggacccaccaggccctggccggcgaggtgccggcc
gcggagggcgtcctggagcacaaccgcgacctggtcgagccgctgcaactgtgccacgag
tcgctgcacgcctgcggcatgggcgtgatcgccgatggcgcgttgctcgactgcctgcgc
cgcgccgccaccttcggcctgttcctggtacgcctggacgtgcgccaggactcggcccgc
catgccgccgcgctgagcgagatcaccgagtacctggagctgggcagctacgacgagtgg
gacgagaagacccgcctggaattccttctcgaggaactgaacagccgccgccccctgctg
ccggcgcactaccagccttcggcggataccgccgaggtgctcgccacctgccgggcgatc
gccgccgcaccaccggcgtcgctggggtcctacgtgatctcgatggccggccagccgtcc
gacgtgctggcggtgcaactgctgctaaaggaaagcggcgtcgactggccgatgcgcgtg
gtgccgctgttcgagaccctcgacgacctggacaacgccggcccctgcatggagcgcctg
ctgacgctgccgggctaccgttcgcggctctccggggtgcaggaagtgatgatcggctac
tccgattcggccaaggacgccggtactctcacggcggcctgggcgcagtaccgggcgcag
gagaaactggtggagatctgccgccagcacgaggtcgagttgctgctcttccacggccgc
ggcggtaccgtcggtcgcggcggcgggccggcccacgcggcgatcctgtcgcagccgccg
ggttcggtggccgggcgcttccgggtcaccgaacagggcgagatgatccgcttcaagttc
ggtctgccggacatcgccgaacagaacctcaatctctacctcgccgcagtgctggaagcg
accctgatgccgccgccggctccggagccggcctggcgcgcgcagatggaccgcctggcg
aaggacgcgctgctggcctaccgcagggtggtgcgcgacgatccgcagttcgtcgagtat
ttccgcctggccacgcccgagcaggaactgggccgtctgccgctgggcagccgcccggcc
aagcgccgcgaaggcggggtggagagcctgcgggcgattccctggatcttcgcctggacc
cagacgcgcctgatgctgccggcatggcttggctgggagaccgccttgctgaacgccatc
gagcgtggcgagggcgcgctgctcgggcagatgcgcgagcgatggccgttcttcaccacc
cgcatcgacatgctggaaatggtcctggccaaggccgacgcggatatcgcgcggctctac
gacgaacgtctagtgccgctcgagctgcgtccgctggggcgtcgtttacgcgacctattg
tcgcaggcggtgcgcgtggtactgggactgaccgggcagtcgctgctgctcgcccacgcc
agcgagacccgcgagtcgatcagcgtgcgcaacagctatctagacccgctgcacctgctc
caggctgagcttctggcccgttcgcggcgctgccggggcgacgcctgcggcggcctggag
caggcgctgctggtgacggtcgcgggggtcgccgccggactgcgcaacaccggatga

DBGET integrated database retrieval system