KEGG   Pseudomonas alcaligenes: A0T30_09515Help
Entry
A0T30_09515       CDS       T04318                                 

Definition
(GenBank) peroxidase
Organism
palc  Pseudomonas alcaligenes
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2074990..2077725
Genome map
AA seq 911 aa AA seqDB search
MSVWVTWPSLVKFGTLGIYAGLITLALERDVLFKENLFDVDNLPAANATITCDARSQVAR
TEDGTCNILSNPAEGSVYRRFGRNVNPAVTHGETEADTLLSPNPREVSNVLMARGEFKPA
PSLNFIAASWIQFMVHDWVEHGPNAEANPIQVPLPAGDVLGSGNLSVRRTQADPTRTAAE
AGKPATYRNHNTHWWDGSQLYGSNKATNDKVRAFVDGKLKINPDGTLPTDFISGKPITGF
NENWWVGLSMLHQLFTKEHNAIAAMLKQKYPDKDDQWLYDHARLVNAALMAKIHTVEWTP
AVIANPVTERAMYANWWGLLGSGPNRDKYQEEARMLQEDLASSNSFVLRILGIDGSQAGS
SAIDHALAGIVGSTNPNNYGVPYTLTEEFVAVYRMHPLMRDKVDVYDIGSNIISRSVPLQ
NTRDRDAESLLNGEHPQRLWYSFGITNPGSLTLNNYPNFLRNLSIPLVGNIDLATIDVLR
DRERGVPRYNEFRREIGLNPITKFEDLTTDPATLANLKRIYGNDIEKIDTLVGMLAETVR
PDGFAFGETAFQIFIMNASRRLMTDRFYTKDYRPEIYTAEGLAWVENTTMVDVLKRHNPD
LVDSLVGVENAFKPWGLNIPADYQTWPAKAKQDNLWVNGALRSQYADGQLPQLADTNTSA
LLANTLWKKVREDVDVVPADYTKGMHQHGVMAKVKFKPVAGNPYTGLFQGADHGLLRLSL
AAEPGKNGFQPGLSWKAFVDGKPSRNVAALQSWAGQGQNYNFFANELSQIVDAGLVDSLQ
VLFAAVSLKPTQLRVDHLAKIKQDGQSVSSVKAPTQVYFVPRAEVRSLFSTAAHDFRNDL
VTLNAGTTLYDVYATSMEVKTSIIPSTNRSYAQQRRSSAVKVGELELTSPFIASAFGDSG
VFFKHQRSEDK
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttgggtcacgtggccgagcttggtcaagttcggcactctgggcatctacgcc
ggcctgatcacactcgcgctcgagcgcgatgtgctgttcaaggaaaacctgttcgacgtc
gacaacctgcctgccgccaacgccaccatcacctgtgatgcgcgcagccaggtcgcgcgt
accgaggacggtacctgcaacatcctttccaacccggctgagggctccgtttaccgccgt
ttcgggcgcaacgtgaaccccgccgtgacccatggcgagaccgaagccgataccctgctc
agccccaacccgcgggaagtgagtaacgtgctgatggcccgtggcgagttcaagccggcg
cccagcctcaacttcatcgccgcttcctggatccagttcatggtgcatgactgggtcgag
cacggtcccaacgccgaagccaatccgatccaggtgccgctgccggctggcgacgtgctc
ggttccggcaacctctccgtgcgccgcacccaggccgatccgacccgtaccgcagccgag
gccggcaagccggccacttaccgcaaccacaacactcactggtgggacggttcgcagctg
tacggcagcaacaaggccaccaacgacaaggtccgtgccttcgtcgatggcaagctgaag
atcaatccggacggcaccctgccgaccgatttcatcagtggcaagccgatcaccggcttc
aacgagaactggtgggtcggcctgagcatgctgcaccagctgttcaccaaggagcacaac
gccatcgcggcgatgctcaagcagaagtatccggacaaggacgaccagtggctgtacgac
cacgcacgcctggtcaacgccgcgctgatggccaagatccacaccgtggaatggaccccg
gcggtgatcgccaacccggtcaccgagcgtgccatgtacgccaactggtggggcctgctg
ggctccggcccgaaccgcgacaagtaccaggaagaggcgcgcatgctgcaggaggacctg
gccagctccaactccttcgtcctgcgcatcctcggcatcgacggcagccaggccggcagc
tcggccatcgaccatgccctggccggtatcgtcggttcgaccaacccgaacaactacggc
gtgccttacaccctcaccgaggagttcgttgcggtctaccgcatgcacccgctgatgcgc
gacaaggtcgatgtctacgacatcggctccaacatcatctcgcgcagtgtgccgctgcag
aacacccgtgaccgcgatgccgagagcctgcttaacggcgaacatccgcagcgtctgtgg
tactccttcggcatcaccaacccgggctcgctgaccctcaacaactacccgaacttcctg
cgcaacctgtcgattccgctggtcggcaacatcgacctggcgaccatcgacgtgctgcgt
gaccgcgagcgcggcgtaccgcgctacaacgagttccgccgcgagatcggcctcaatccg
atcaccaagttcgaggacctgaccaccgatccggccaccctggccaacctcaagcgcatc
tacggcaacgacatcgagaagatcgacaccctggtcggcatgctggccgagaccgtgcgt
ccggatggcttcgctttcggcgagacggccttccagatcttcatcatgaacgcctcgcgc
cgcctgatgaccgaccgcttctacaccaaggactaccgcccggagatctacaccgccgag
ggtctggcctgggtcgagaacaccaccatggtcgacgtgctcaaacgccacaatccggat
ctggtcgacagcctggtcggcgtcgagaacgccttcaagccctggggtctgaatatcccg
gccgactaccagacctggccggccaaggctaagcaggacaatctgtgggtcaacggcgcc
ctgcgtagccagtacgccgatggtcagctgccgcagctggctgacaccaacacctcggcc
ctgctggccaacaccctgtggaaaaaggtgcgtgaggacgttgacgtagtgccggccgat
tacaccaagggcatgcatcagcatggcgtgatggccaaggtcaagttcaagcccgtggct
ggcaacccctacaccggcctgttccagggcgcggaccacggtttgctgcgcctgtcgctg
gccgccgagccaggcaagaacggcttccagccgggactgtcgtggaaggccttcgtcgat
ggcaagccttcgcgcaacgtcgcggccctgcaaagctgggctggtcaggggcagaactac
aacttcttcgccaacgagctgtcgcagatcgttgatgcagggctggtcgacagcctgcag
gtgctgttcgccgcggtctcgctgaaaccgacccaactgcgggtcgatcatctggccaag
atcaagcaggacggccagagcgtctcgtcggtcaaggcaccgacgcaggtctacttcgtg
ccacgggcagaagtgcgcagcctgttctccaccgcggcgcacgacttccgtaatgacctg
gtgacgctcaacgccggtaccacgctgtatgacgtgtatgccacctcgatggaggtcaag
acctcgatcatcccgtccaccaaccgcagctacgcccagcaacggcgcagcagcgcggtg
aaggttggcgagctggagctgacctcgccgttcatcgcctccgcgttcggtgacagtggt
gtgttcttcaagcaccagcgcagcgaagacaagtaa

DBGET integrated database retrieval system