KEGG   Pteropus alecto (black flying fox): 102886191Help
Entry
102886191         CDS       T02993                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00310  Lysine degradation
pale04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102886191 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102886191 (SETDB1)
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102886191 (SETDB1)
Chromosome [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102886191 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102886191 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 102886191
NCBI-ProteinID: XP_015450951
LinkDB All DBs
Position
Un
AA seq 1295 aa AA seqDB search
MSSLPGCLGLDAATAAVESEEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQEL
HKGALSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKHGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPMELPQPAAPPAPPGPPTPPAPPLSPQAGDIES
LESQLAQSRKQVAKKSTSFRPGSVGSGHSSPASPALSENVSSGKPGINQTYRSPLGSTSA
SAPSGPPAPSAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPILSEQYRG
KNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLE
MFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKG
VFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPT
GVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKI
LTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTE
DPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGVSETASKDSRPPDLGPPH
IPVPLAIPMGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTSEGGEGRAAG
GRGEAEKASTSGLGLKDEGDIKPAKKEDPDDRNKMSVVMESARNYGYNPSPMKTEGLRRP
PSKTSMHQSRRLLASAQPHADDVLTLSSSTESEGDSGASRKPAAGQTAATAVDSDDIQTI
SSGSEGDDFEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVRKN
TRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIR
AGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccccggctgccttggtttggatgcagcgacagctgcagtggagtccgaa
gagattgcagagctgcagcaagcagtggttgaggagctgggtatctcgatggaggaactt
cggcagttcatcgatgaagaactggaaaagatggactgtgtacagcaacgcaagaagcag
ttagcagagttggagacgtgggtaatacagaaggaatcggaagtggcccatgttgaccag
ctctttgatgatgcgtccagggcagtgactaattgtgagtctttggtgaaggacttttac
tccaaactgggactacagtaccgggacagtagctccgaggatgaagcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtcctcagtattgattcaggtgatgcc
gggagcagaactccaaaagaccagaagctccgtgaagctatggctgccttaaggaagtcg
gctcaggatgtccagaagttcatggatgctgtcaacaagaagagcagttcccaggagctg
cacaaaggagccctgagtcagatgtctggagaactgagcaaagatggtgacctgatagtc
agcatgcgcattctgggcaagaagagaaccaagacttggcacaaaggcacccttattgcc
atccagacggttgggccgggaaagaagtacaaggtgaaatttgacaacaaaggaaagagc
ctgctgtcggggaaccacattgcctatgattaccaccctcctgctgacaagctatatgtg
ggcagtcgagtggtggccaaatacaaagatggcaatcaggtctggctctatgctggcatt
gtagctgagacgccgaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tacgcttcctatgtcacacagtccgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagatttcatcgaggagtacatcactgcttat
cccaaccgccctatggtgctgctcaagagcggccagctcatcaagaccgagtgggaaggc
acgtggtggaagtcccgggttgaggaggtggacggcagcttggtcaggatcctcttcctg
gacgacaaaaggtgtgaatggatctaccgaggctccacgcggctggagcccatgttcagc
atgaagacgtcctcggcctccgcgctggagaagaagcacggaggacagctcaggacacgt
ccgaacatgggtgctgtgaggagcaaaggccctgtggtccagtatacccaggatctgacc
agcactggaacccagtttaagccaatggagctcccacagcctgcagccccacccgcccca
cccggtccacccaccccacctgctccacctctgtccccccaggcaggtgacattgaaagc
ttagaaagccagcttgctcagtcacggaagcaggtggccaaaaagagcacgtctttccgg
ccaggatctgtgggctctggtcactcctcccccgcgtcccctgcactcagtgaaaatgtt
tccagtgggaaacctggaatcaaccagacatatagatcacctttgggctcaacctctgct
tcagcgccatcaggaccgccagcaccctcagcacccccagccttccatggcatgctagag
cgggccccggcagagccctcctaccgcgcccccatggagaagcttttctacttacctcac
gtctgcagctatacgtgtctgtcccgagtcagacccatactaagtgagcagtaccggggc
aagaaccctctgctagtcccgctcctgtatgacttccggcggatgacagcccggcggcgg
gttaaccgcaagatgggctttcacgttatctataagacaccctgtggcctctgtcttcgg
acaatgcaggagatcgagcgctacctttttgagactggttgtgacttcctcttcctggag
atgttctgtttggatccgtatgttctcgtggaccggaagtttcagccctataagcctttc
tactatattttggacatcacctatgggaaagaagatgttcccctatcctgtgtcaatgag
attgacacaacacccccaccccaggtggcctacagcaaggaacgaatcccgggcaagggt
gttttcattaacacaggccctgaatttctggtcggctgtgactgcaaggatggatgccgg
gacaagtccaagtgcgcctgtcatcagctaactatccaggccacagcctgcaccccaggc
ggccaaatcaacccaaactctggctaccagtacaagaggctagaagagtgtctgcccacc
ggagtttatgagtgtaacaaacgctgcaattgtgacccaaacatgtgcacaaaccggttg
gtgcagcatggactacaggttcggctacagctgttcaagacgcagaacaagggctggggt
atccgctgcttggatgacattgccaagggctcctttgtctgtatttatgcaggcaaaatt
ctgacagacgacttcgcagacaaagagggcctggaaatgggcgatgagtactttgccaac
ctggaccacatcgagagcgtggagaacttcaaggaaggatacgagagtgatgccccctgt
tcctctgacagcagtggggtagacctgaaggaccaggaggatggcaacagcggcacagag
gaccccgaggagtccaacgacgatagctcagatgataacttctgtaaggacgaggacttc
agcaccagctcagtgtggcgcagctatgccacccggcggcagacccggggccaaaaagaa
aacggagtgtctgagacggcgtccaaggactcgcgccccccagacctcgggcccccacat
attcccgtccctctggcgatccccatgggtggctgcaatccaccttcctctgaagagaca
cccaagaacaaggtggcctcctggttgagctgcaatagtgtcagcgaaggtggctttgct
gactccgacagccattcatccttcaagactagcgaaggtggggaaggccgggcagcggga
ggcagaggggaagctgagaaggcctccacctcagggctgggcctcaaggatgagggagac
atcaagccggccaagaaagaggaccctgatgaccgaaacaagatgtcagtcgttatggag
agcgctcggaactacggttacaatccttctcccatgaagacggaaggccttcggcgccca
ccgagtaagacgagtatgcaccagagccgacgcctgctggcctcagctcagccccatgcc
gatgatgtgctgacgctgtccagcagcacagaaagtgagggagacagcggcgccagccgg
aagcccgctgccggtcagactgcagccacagcggtcgacagcgacgacatccagaccatc
tcttccggctctgaaggcgacgactttgaggacaagaagaacatgtccggtccaatgaag
cgccaggtggcagtgaaatcaacacgagggtttgctcttaagtcgacccatgggatcgcc
attaagtcaaccaacatggcgtccgtggagaagggggaaagcgcccccgttcgtaagaac
acacgccagttctacgacggggaggagtcttgctacatcatcgacgccaagctcgaaggc
aacctgggccgctacctcaaccacagttgcagccccaacctgtttgtccagaatgtcttc
gtggatacacacgaccttcgcttcccctgggtggccttctttgccagcaagagaatccgg
gctgggacagaacttacttgggactacaactacgaggtgggcagcgtggaaggcaaggag
ctgctctgctgctgtggggccatcgagtgcagagggcgtctgctctag

DBGET integrated database retrieval system