KEGG   Pteropus alecto (black flying fox): 102887872Help
Entry
102887872         CDS       T02993                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102887872 (HDAC6)
  Substance dependence
   05034 Alcoholism
    102887872 (HDAC6)
  Infectious diseases
   05165 Human papillomavirus infection
    102887872 (HDAC6)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102887872 (HDAC6)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102887872 (HDAC6)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102887872 (HDAC6)
Membrane trafficking [BR:pale04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102887872 (HDAC6)
Chromosome [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102887872 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 1140 aa AA seqDB search
MTSTGQDSTTTKQRSRHNPHSTPHDSNVTSKRGTKKGATLHSSPKLAEVKKKGRMKKLSQ
ATGQDLIVGLQGLDLNVEAKTLSGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQ
EGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRILADTYDSVYLHPNSY
TCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQK
HGIQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQ
GYTINVPWNQVGMRDADYIAAFLQVLLPVALEFHPQLVLVAAGFDALQGDPKGEMAATPA
GFAQLTHLLMGLAGGRLILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGAPCPSAQ
SSLSCALEALEPFWEVLVRSGETREEDNVERDNAEEEEEEEEEPWQPPELPILTWPVLQA
RTGLVYDQQMMGHYNLWDNHHPEMPQRISQIMCRLEELGLSRRCLILPARPATDAELLTC
HSAEYVGRLRATEKMKPRELHREGANFDSIYICPSTFACAKLAAGSTCCLVEAVLAGEVL
NGVAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQVISGHALRILIVDWDVHHGNGTQHI
FEEDPSILYISLHRYDHGTFFPMGDEGASNQVGWAAGMGFTVNVAWNGPRMGDAEYLAAW
HRVVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILE
GGYNLTSISESMAACTRTLLGDPPPLLTLPRPPLSGALASIAKTIQIHRKYWRSLRVTKF
EDKEGPSSSKLTKEAPQPANPESAERLTTLEGNILDASTEKDTSASSVQESTPAQTKSQT
DVVERTQDQPSEAAKGEPMLDKTTSEAATPDQTTSEAAMLGQTTSEEAAEIAKLIQTPPA
SPVQGATAQISLSKLIGNLRTLELDNKAQEAPESQIPEEERLLGEAAGGQDVDNSVLMQA
FGNTDQVMFYAVTPLPWCPHLVAVCPIPEAGLDVTQPCQDCGALQENWVCLSCYEVYCGR
YISAHMLQHYEVSGHPMVLSYVDLSTWCYQCQAYVHHQALLDVKNVAHQNKFGEDMPHSH
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgacctccactggccaggattccaccacaaccaagcagcggagtaggcacaacccccac
tcgaccccccacgactccaacgtcacctcgaagcgaggtactaagaagggtgccacgctc
cactccagccccaaactagcagaagttaagaagaaaggcagaatgaagaagctcagccag
gcaacagggcaagacctaatcgtggggctgcaagggctggatctgaacgttgaggccaag
acactgtctggtactggcttggtgttagatgagcagctcaatgaattccactgcctctgg
gatgacagcttccctgaaggccccgagcggctccatgccatcaaggaacaactgatccag
gagggcctcctggaccgctgtgtgtcctttcaggcccggtttgctgaaaaggaggagctg
atgttggttcacagcctagaatacattgatctgatggagacaacccaatacatgaatgag
ggagaactccgtatcctagcagacacctatgactcagtttatctgcatccgaactcatac
acctgcgcctgcctggcttcaggctccgtcctcaggctggtggatgcagtcctgggggca
gagatccggaatggcatggccatcatcaggcctcctggacaccacgcccaacacagtctc
atggacgggtattgcatgttcaaccatgtggccgtggctgcccgctacgctcaacagaag
catggcattcagagggtccttatcgtggattgggatgtacaccacggtcagggaacacag
ttcacctttgaccaagaccccagcgtgctctatttctccatccaccgctacgagcagggt
cggttctggccccacctgaaggcctctaactggtccaccacaggttttggccagggacag
ggatacaccatcaatgtgccttggaaccaggtggggatgcgagatgccgactacatcgct
gctttcctgcaagtcctactgccagtcgcccttgagttccacccccagctggtcctggtg
gctgctggatttgatgcccttcaaggggaccccaagggtgagatggctgccactccggca
gggtttgcccagctaacccatctgctcatgggtctggcaggaggcagactgatcctgtct
ctggagggtggctacaacctccgctccctggctgagggcgtcagtgcctcacttcacacc
ctcctgggagacccttgccccatgctggagtcccctggtgccccctgcccaagtgcccag
tcttcactgtcctgcgctctggaagccctggagcccttctgggaagtccttgtgagatca
ggtgagacccgggaggaggacaacgtggagagggacaatgcagaagaggaggaagaggag
gaggaggaaccatggcagccccctgagctcccaatcctgacgtggccagtgctgcaggct
cgcacagggctggtctacgaccaacagatgatgggtcactacaacttgtgggataaccac
caccccgagatgccccagcgcatctcacagatcatgtgccgtctggaggagctgggcctt
tctaggcgctgcctcatcctgcctgcacgtcctgccacagacgctgagctgctcacctgc
cacagtgctgagtatgtgggtcgtctgcgggccacagagaagatgaaaccccgggagctg
caccgcgagggtgccaactttgactccatctacatatgccccagcaccttcgcctgtgcg
aagctggctgccggctccacatgctgccttgtggaggctgtgctggcaggagaggttttg
aatggtgttgctgtggtgcgtcctccgggacaccatgcagaacaggatgctgcctgtggt
ttctgctttttcaactctgtagctgtggctgctcgccatgcccaggtcatcagtgggcat
gctctgcggattttgatcgtggattgggacgtccatcacggtaatggaactcagcatata
tttgaggaggatcccagcatactctacatttccctgcaccgctatgatcatggcaccttc
tttcccatgggggatgagggtgccagcaaccaggtgggctgggccgcgggcatgggcttc
actgtcaatgtggcctggaatgggccccgcatgggtgacgctgagtacctggctgcttgg
catcgtgtggtgcttcccattgcctacgagtttaatccagaactggtgctagtctcagct
ggctttgatgcagcacggggggacccgttggggggctgccaggtatcacctgagggctat
gcccatctcacccacctgctgatgggccttgccagtggccgcattatcctaatcctagag
ggtggctataacctgacatccatctcagagtccatggctgcctgcacccgtaccctcctt
ggggacccgccacccctgctgaccctgccacggcccccactatccggggccctggcctcg
attgctaagaccatccaaatccatcgcaaatactggcgcagcttacgggtcacaaaattc
gaagacaaggagggaccctccagttctaagttgaccaaggaggcaccccaaccagcaaat
cctgagtcagctgagaggctgaccacactagaagggaacattctggatgcaagcacagaa
aaggacacctcagcatcatctgttcaagagtctactccagcccagactaagtcacagacg
gatgtggtagagcgcactcaggaccagccctcagaggcagccaagggggaacccatgctg
gacaagaccacctcagaggcagccacgccagaccagaccacctcagaggcagccatgctg
ggccagaccacctcagaggaggctgcggaaattgccaagctgatccaaacccctccagcc
tcacctgtgcaaggagccacagcccagatatccctaagtaagctgattgggaatctcagg
accttggaactagacaacaaggctcaggaggccccagagtctcagatcccagaagaggag
aggctacttggagaagcagctggaggtcaggacgtggataattcagtgctgatgcaggcc
tttgggaacactgaccaggtcatgttttatgctgtgacaccactgccttggtgtccccat
ttggtggcagtatgccccattcctgaagcaggcctggacgtgacccagccttgccaggac
tgtggagcactccaggagaactgggtgtgtctgtcttgctatgaggtctactgtggtcgt
tacatcagtgcccatatgctacagcactacgaagtctcaggacacccaatggtcctcagc
tatgtcgacctttctacctggtgttaccaatgtcaggcctatgtccaccatcaggctctc
ctagatgtgaagaacgtcgcccaccaaaacaagtttggggaggacatgccccactcacac
taa

DBGET integrated database retrieval system