KEGG   Pteropus alecto (black flying fox): 102888329Help
Entry
102888329         CDS       T02993                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00240  Pyrimidine metabolism
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102888329 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102888329 (TK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102888329 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 102888329
NCBI-ProteinID: XP_006912239
UniProt: L5KLX6
LinkDB All DBs
Position
Un
AA seq 243 aa AA seqDB search
MSCVNLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRLRRFQIAQYRCLMIKYAKDTR
YSDSFCTHDRNTMEALPACLLRDVAQEALGVTVIGIDEGQFFPDIVEFSEAMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGMEKEVEVIGGADK
YHAVCRLCYFRKASGQPDGLDSNEDKENWLVLGKLGEAAEARAATGARKPLAAHQILQRS
PPN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgtcaacctgcccacggtgctgcctggctcccccagcaagacccgggggcag
atccaggtgatcctcggacccatgttctcaggaaaaagcacggagctcatgagacggctc
cgacgcttccagattgcccagtacaggtgcttgatgatcaaatacgccaaagacacgcgg
tacagcgacagcttctgcacgcatgaccggaacaccatggaggcgctgccggcctgcctg
ctccgcgacgtggcccaggaggccctgggcgtgactgtcataggcatcgacgaagggcag
tttttccctgacattgtggagttcagcgaggccatggccaacgccgggaagactgtgatt
gtggctgcactggatggaaccttccagaggaaggctttcgggaccatcctgaacctggtg
cccctggccgagagcgtggtgaagctgacggccgtgtgcatggagtgcttccgcgaagcc
gcctacaccaagaggctgggcatggagaaggaggttgaggtgatcggaggagctgacaaa
taccacgctgtgtgccgcctctgctacttccgaaaggcctcgggtcagcccgacgggctg
gacagcaacgaggacaaggagaactggctggtgctgggaaagctgggggaggccgcggag
gccagggcggccacgggggcccggaagcccctcgctgcgcatcagatcctgcagcgcagc
ccccccaactga

DBGET integrated database retrieval system