KEGG   Pteropus alecto (black flying fox): 102894853Help
Entry
102894853         CDS       T02993                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102894853 (SUV39H1)
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102894853 (SUV39H1)
Chromosome [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102894853 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102894853 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNFYDFEVEYLCDYKKIREQEYY
LVKWRGYPESESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRNHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgtagtgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcttggccaagctctcctgtcctgcccttggcatctccaagaggaacttc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaatattac
ctggtaaaatggcgtggatacccagagtcagagagcacctgggagccacggcagaatctc
aagtgtgtgcgcattctcaagcagttccacaaggacttagaacgcgagctactccggcgg
catcaccggtcaaagccaccccggcatctggacccaagcttggccaactacctggtacag
aaggccaagcagaggcgggcgctgcgacgctgggagcaggagctcaatgctaaacgcaac
catctgggacgcatcactgtagagaatgaggtggacctggacggccccccgcgggccttt
gtatacatcaatgagtaccgtgttggtgagggcatcacccttaaccaggtagctgtgggc
tgcgagtgccaggactgtctgtgggcacctgctggaggctgctgccccggggcatcactg
cacaagtttgcctacaatgaccagggccaggtgcggctgcgagctgggctgcccatctac
gagtgcaactcccgctgccgctgtggctatgactgccccaaccgcgtggtacagaagggc
attcgctacgacctctgcatctttcgcacagatgatgggcgtggctggggcgtccgcacg
ctggagaagatccgcaagaacagctttgtcatggagtacgtgggagagatcattacctca
gaagaggcggagcggcggggtcagatctacgaccgccagggtgccacatacctcttcgac
ctggactacgttgaggacgtatacaccgtggatgccgcctattatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacatttgattacaatatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccccaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system